SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024746m|PACid:20194498 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024746m|PACid:20194498
Domain Number 1 Region: 261-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-18
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 60-184
Classification Level Classification E-value
Superfamily POZ domain 0.0000000173
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024746m|PACid:20194498
Sequence length 591
Sequence
MASTARFSGSSVISNTTTANSFFAESSFDYTAADFHTATEVKPLQLLSNCLESVFDSPET
FYSDAKLVLADGKEISFHRCVLSARIPVFKTALAAAAKDRKSTAVKLELKEIARDYEVGF
DSVVTVFAYVYSGRVRPSPKGASDCVDEDCRHVACRPAVDFMVELLYLAFVFQIPELVTL
YERQFLDIVDKILIEDLLVIFKLANICGKTYKKLFDTCVEILAKTDVEIVTLDKSLPQHI
VKQIVTIRKELGLEPRKLDKHVTNIYKALDSDDVELVKMLLKEGHTNLDEAYALHFAVAH
CDVKTGFDLIDLELADVNVRNPRGYTALHVAALRNEPKLIVYLLTKGANASETTFDGRTA
LVIAKRLTKAADYNTSTEQGKVSMKGGLCIEVLEHASKLGRFPREDSPSLPVTPDELRMR
LLYLENRVALARILFPAEAQVIMDIVKLEETREFTASSLEPDHLTCAKRTSLDLNMAPFV
IREEHLCRLRALMKTVSLGKRYFPRCSLDHFMDTEDLNHLACVEEDTPEKRLQKKQRYME
LQETLMKTFSEDKEECVKSPTSRSMRSNGKLSHRRLRVVDKRDFEKRPCGN
Download sequence
Identical sequences V4MHA7
Thhalv10024746m|PACid:20194498 XP_006413224.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]