SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024752m|PACid:20194328 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024752m|PACid:20194328
Domain Number 1 Region: 45-189
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000235
Family BTB/POZ domain 0.044
Further Details:      
 
Domain Number 2 Region: 268-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000451
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024752m|PACid:20194328
Sequence length 588
Sequence
MAAATEMEPSSSISFASSHLYNPPPLVTNHHSAANLEAVSLIKLSSDLEQLLTNSDCDYT
DAEIIIEGESHAVGVHRCVLASRSTFFLELFKKDKETIAKSEQKPNYHMKDLLPYRNVGR
EAFLHLLNYIYTGRLKHFPMEVSTCVDTVCAHDSCKPAIDFAVELMYASHVFQIPELVSS
FQRRLCNYIEKSLVENVLPILLVAFHCDLTQLLDQCIDRVARSDLDRFCIEKELPFEVSE
KIKKLQIKSVNIPEVVDKPLERTGKVLKALDSDDVELVKLLLTESDITLDQANGLHYAVA
YSDPKVVAEVLALDMADVNFRNSRGYTVLHIAAMRREPSIIISLLGKGANTSDLTFDGRS
AVNICRRLTRPKDYYTKTVKGQEANKDRLCIDVLEREIRRNPLASGGDTPTCSHSMPEDL
QMRLLYLEKRVGLAQLFFPTEANVAMDIANVEGTSEFTGLLVPPPSNGATGNLSQVDLNE
TPYMQTKRLLARMEALMKTVETGRRYFPSCSEVLDKYMDEYMDEDIPDMSHPEKGSVKER
RLKRMRYKELKNDVKKAYSKDKEAKIARSCLSSSSPASSLREALENPT
Download sequence
Identical sequences E4MXE8 V4P734
XP_006413943.1.70970 Thhalv10024752m|PACid:20194328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]