SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024778m|PACid:20195017 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024778m|PACid:20195017
Domain Number 1 Region: 270-373
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  Thhalv10024778m|PACid:20195017
Domain Number - Region: 500-533
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0221
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024778m|PACid:20195017
Sequence length 575
Sequence
MESTKVCMNAQCGAASTSGEWKRGWPMRSGELASLCDKCGSAYEQSIFCQVFHAEESGWR
ECNSCDKRLHCGCIASRFMMELLDNGGVSCISCAKKSGFFSMNVNHEANGRGFPSFASPE
HGTNLKHLLHFQRIGSTQSFFQMKQEDSLLPALRHKTEKQELSAQPNLSISLGFTSPFHD
AVVDDTSKATPIFQLAPRSRQLLPKPANSAPTSAGMEPNGSLVSQIHVARPPPEGRGKTQ
LLPRYWPRITDQELQQLSGQYPHLSNSKIIPLFEKVLSASDAGRIGRLVLPKACAEAYFP
PISQPEGLPLKIQDIKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRT
EPEGKLVMGYRKATNSTAAQMFKGSSEPNLSMFNNNLSPGCGDINWSKLEKPEDMAKDNL
LLQPSLTSARKRVRNIGNKSKRLLIDSVDALDLRVTWEETQDLLRPPQSVKPSICTVEDY
DFEEYDEPPVFGKRTVFVSRQTGEQEQWVQCDACGKWRRLPVDTLLPPKWLCSDNVLDPG
RSSCSAPDELSPREQDTLIRLSKGMILNHYRSVTF
Download sequence
Identical sequences V4MMG6
XP_006412525.1.70970 Thhalv10024778m|PACid:20195017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]