SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10026818m|PACid:20193545 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10026818m|PACid:20193545
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.39e-19
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 126-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 3 Region: 251-353
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-18
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10026818m|PACid:20193545
Sequence length 359
Sequence
MANPPLQSPTNPHFFQPLLPGFDTNFTIPVAFFSKHIEGKNDLKTAKLRSDASEITWEVK
LDGRRLTGGWKDFTTAHDLRIGDIVVFKHEGDMVFNVTPFGPSCCEIQKKTLKPKTEPKS
SLSFDYCFVAEVTASNIKSDKLRLPMEATSSNALNRGCHKMIVVNEEGKSWTLSLRFRES
DTSYYIGGGWTRFCRENKRKAGDSILFNLVGDGRSTPMICICPEEECSELMSKYMGKKKI
KRRPIWVASSSSRQNRFVTIILTHYNMRHSKLILPINFVKINGINKHEEIILKDKHGVKR
LTKLTKDGPNYGRRGLGKGWKDFCKANDVFKIGQPFKLELIWEDTIPVLKFCSKIESIS
Download sequence
Identical sequences V4MC96
XP_006412566.1.70970 Thhalv10026818m|PACid:20193545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]