SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027418m|PACid:20195830 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027418m|PACid:20195830
Domain Number 1 Region: 172-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-21
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 8-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000255
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 3 Region: 312-409
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000255
Family B3 DNA binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027418m|PACid:20195830
Sequence length 516
Sequence
MDRVISSSTKKPIFVIDLSEQSSNPMIPDSFISKHFNGKFQSTKLKLTSDASDRAWEVGL
DGQRFADGWKTFSDHHCVRYDDVLIFRHDGDMVFHVTPLGRSFSHQIQFLSSTSDDENDD
DDSGSEDNIFDDDDDDDNADVKDDDDDGDDDYSTSEEDLYPKKTSSKKRARSEKSYLVAH
VTASNLSRNHICLTNKFARANGLNNRQCEIDLRNEEGKSWTMDLRHNKTTGQAFISRGWR
SFCKENGLKAESFCRFECVQSGTKPVLQLCPNSSSIPDGNSSKVNEKRNVSETEGDEIES
PDRSQTAASMVQNRIFTLALKPYMLRTGQLRLPASLSRGNGINEAGEITVVNKLGVEWKL
HLVNIKGRGQFYIRRFKDCFVANGIKKINDSFTLEVVRGGTSPILKICTEERKTPQTVQA
LRAGEATETPVQKRSRVCVEGGPSRCTRASNKSSGEPENLQGKQPLQSCSISDQVTKVKQ
SIVETLTDVKRFRSELEIKEQNLEASLLEIDELGMI
Download sequence
Identical sequences V4MFL2
Thhalv10027418m|PACid:20195830 XP_006412574.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]