SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10027687m|PACid:20189991 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10027687m|PACid:20189991
Domain Number 1 Region: 275-622
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-93
Family IF2B-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10027687m|PACid:20189991
Sequence length 629
Sequence
MESRRNPRAVVDPKVRQVGFFTSSSQPDSTPQPDPIAPASHPVSSISPSGNSLSPVMIPP
PRHNSSDTFPLRAAAASAVSPSSFSYSSRRDFPDGSTTASPGRVSRGSFAKSSVPAASSL
PGVGMDSMAAATSSSVPASRLTTVSIVNMPPGLTEKASGKQVQSDQMKNSKPLKEKTTKA
ERRALQEAQRAAKAAAKAEGGKAPLVTSGSVASTSKAAKPAKPSSQKNEGAVAAGPSEKD
RKKDAPHPRMQYDDESRVVKAKRRAVVKQTEAKNRVELFRHLPQYEHGTQLPDLETKFFQ
LDPMHPAVYKVGLQYISGDISGGNARCIAMLQAFQEVVRDYSTPPEKTLNRDMTAKISSY
VSFLIECRPLSVSMGNAIRFVKNRIAKLPITLAEYEAKAALQSDIERFINEKIIMADNVI
VKHAVSKIRDGDVLLTYGAATAVEMVLLHAHELRKKFRVLVVDSRPKLEGQLLLRRLIKR
GINCTYTHINAISYIMHEVTKVFLGASSVLSNGTVYSRVGTACVAMVASAFRVPVLVCCE
AYKFHERVQLDSICSNELGDPNAISKVHGREDINYLDGLTNNANLQFLNLMYDATPSDYI
SMIITDYGMVPPTSVPVIVREYQKEHLLV
Download sequence
Identical sequences V4NL99
Thhalv10027687m|PACid:20189991 XP_006405733.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]