SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10028136m|PACid:20189592 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028136m|PACid:20189592
Domain Number 1 Region: 87-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000687
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 8-65
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000235
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028136m|PACid:20189592
Sequence length 286
Sequence
MKLKLTSDASDRTWEVKLINGQRFSHGWEDFSNAHCLRDDHVLVFRHDGDMLFHVTPTGR
SFSQKKQQCVSSSEEDDNDDDEGMKQSRFLTVTLKPYMLTYKQIRVRRRFAIENGMKEAG
KITLVDKHGDQGFYISKGWIGFCAANELKAGDTFKFEFVGGEGKTPMLKFCWTVQASRDK
DKDGQEDNETRVLKRARVSTEEGSSRCTQASNKSRAEPENLQRKPPLQSCSVSEQLAKVK
QSIVYTLTGIRQFRSELEIKEQNLEASLKELDVLGEKVLEINKILK
Download sequence
Identical sequences V4LAH6
XP_006405977.1.70970 Thhalv10028136m|PACid:20189592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]