SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10028240m|PACid:20189403 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028240m|PACid:20189403
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-20
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 280-377
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-20
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-16
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028240m|PACid:20189403
Sequence length 385
Sequence
MAYSISSSSLANPHFFQPMLPGFNTHLSIPVAFYTKHLQGREEGNEVELRVDVTEITWKV
KIEGRRLTKGWENFTAANDLRVGDFLVFRHEGNLVFHVTPFGPSCCELIYSQEEEDEKNT
KHKTGKLKVKKIPKQECSSSDSDTSFVVPVTASNLRLDGFHLPKSFTTSSGLSTLCQEII
LMDEKGRSSTLEMTYHNSTKRFHVRRGWRAFCCANELKTGCILRLMFFGNGAKPIPRMIP
VERDEKDDDIGKHSKKKKDNLEVEHESVDEKKNVEPLSLSDNYSFVVPVTVCNLRDDRLF
LPVKLSKSNILNESCQEISLMNKQGRTWTLSLKYRKSSNQFCITHGWKSFCHANGQKAGC
SILFKLIRNRTGPVLIMTSEASTSK
Download sequence
Identical sequences V4NLN8
XP_006405883.1.70970 Thhalv10028240m|PACid:20189403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]