SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10028330m|PACid:20189517 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028330m|PACid:20189517
Domain Number 1 Region: 149-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-18
Family B3 DNA binding domain 0.0099
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000153
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 279-359
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000112
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028330m|PACid:20189517
Sequence length 367
Sequence
MVNKHFFKPILPGFHSHLVLSVFLYDSCIAFFSKYIQGTNEQKMTTAKLRSDVSKIAWKV
KIEEDGQKLTDGWKQFALAHDLRIGDILIFRHEKHMAFHVKILGPSGCEVQYESCLDDKS
NLEKTQRKKKVEKNPKTEAGSSSSSLDPSCYVANISPATLRYDSLRLPVKISRENGLDTR
CGEIVLMNEKGTSWKLNLKQKRSCESGTMYIRRGWRSFCSANGLRAGDSITFKLIQRGGN
LVLRLSSTESEEACPEGDEIESLSTKSEKSIWKASSSESQNRLLTLTLKPYNLTKSNLET
KMHLLDKNGVKWYTNLRSAEKGKQIRLVGGWKDFFKANCVKIDEPILLKLIWEGDTSCIL
QFCSKVK
Download sequence
Identical sequences V4M528
XP_006405950.1.70970 Thhalv10028330m|PACid:20189517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]