SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10028372m|PACid:20197905 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028372m|PACid:20197905
Domain Number 1 Region: 194-425
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000245
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 365-581
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000556
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028372m|PACid:20197905
Sequence length 1098
Sequence
MEVVAKSNSKRMYSWWWDSHNTPKNSKWLQENLADMDSNVKKMIKVLEEDADSFARRAEM
YYRKRPELMKLVEEFYRAYRALAERYNHATGVLHHAHQTIAEAFPSQVPLIFGDESHVGA
LTNDVDPHTPDMPPPTRARLGQDEFQNYALKRNMDFSEEPPFMSNGKARKGLNFNDGEGK
GRNVLKDQILSESERACKAEAEVLALKDSLSRMEAEKEARLAQFEKNLERLSNLESEISR
AQEDSRRLNDRSASAEAEIQTLRETIGKLESEKESSLLRYQQCLEKIADLEDGISVVHKD
AGEINERANKAEAETLALKQSLAKAETDKEAALIQYRDCLKTVANLEERLRKAEEDSRLI
NERAENAGVEVENLKQKISKLIEDKEASQLQYQKCLNIIADLKLKLYHAQEETQRLSSEL
QDEVAKLKFSEEKCIVLERSNQNLHSELDGLLEKLGSQSQKLTEKQTELVKLWSSVQEEH
LRFQEAETAFQTLQQLHYQSQEELNNLAVELQTRSRIMNDMEIRNSELHEEIQQAKVENK
GLKKLETMETLVQKNLVLENSISDLNFGLEAIKGKLSMLREACQSLSEEKSGLISESQQT
AIENIVLVEFLRQLNSEAVGIATEKKNLEGKARKTGAKLIDAETENLQLKRNLLSVRSAK
DHLEDEVANVKDQLREKQKELEKIKVEKEMLNQEVFKERSQTELWESQAATFFCDKQISV
VHETLIEAMTHELAEAYNNLEKLKSSQALVLLNESIKSLEDYVSVCRGSVDELSKGDGSM
DEFPKLEDMCLRIKAIAEAVMEKEKFLMLENSNTNSMLEAALKQVKELKNGGGRSMRKQE
GGKMRKQSHEMEIITKDIVLDQTSDGSPYEIISKKGTLELDGHSFFELKPVKTHHKTETA
VRAKGKSLSEESFVVDKLEIFDGFMDPIREVNKRKILERLDSDLRKLENLQITVEDLRNK
VETEEKDKKKVGGEEYETIRGQLEEADEAIEKLFNVNRKLTTKAESEEESSRRRRISEQA
RRGSEKIGRLQLEIQRIQFLLMKLEGEKEKRTRSKISDTNSKVLLRDYIYGGTRSISMKK
KTKKRSTFCGCVQQPRSP
Download sequence
Identical sequences V4L6K4
Thhalv10028372m|PACid:20197905 XP_006396484.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]