SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029127m|PACid:20197407 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029127m|PACid:20197407
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000765
Family B3 DNA binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029127m|PACid:20197407
Sequence length 129
Sequence
MARTKPCPDKPFDPNNQFNILITLKESDTGSSNTITMSKELVEANLFPWWSKHLCAKLSQ
HKSVELVDLFEYESKITTTLIMRKEEDGNFRFHGWGSILGKRNFRTGDIIGFWWDKYYTR
LNFELLLIA
Download sequence
Identical sequences V4KJZ7
XP_006396737.1.70970 Thhalv10029127m|PACid:20197407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]