SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029136m|PACid:20197544 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029136m|PACid:20197544
Domain Number 1 Region: 244-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-17
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029136m|PACid:20197544
Sequence length 375
Sequence
MYYSDHKAVAEKEITSRNFLCLVDAAVMLYEEELRRTEKSKCHTKKKTKTLSAKEEEEEE
RDKRIFRLFPRKTRTSVKKFATRGNPQENLNGSSSSSSFLLDLNTIPADLETRNPQNPCS
SSSSFLLNLNTNAADSETQNPQNPNGASSSSSSFLGNYNIAAEPKNTEMRNPRNPNSQSS
LSSCQTENKSRKRRVAQDIQSKPKKAKVATFSWKGRDTPEWLTLLMKEENESVVKWGERT
DLRLIFEKTLFKTDVNPGESRLSMPSNELIQKDFLTAVEFRVIEEDINNDKKMGIGAILV
DQRDVKWGVMLKRWEMGKRSWNYALTCGWNEIVKANGLKQGDDISIWSFRWGGLLCFALV
TPPPSMAQSSSSLAD
Download sequence
Identical sequences V4L8B2
XP_006397124.1.70970 Thhalv10029136m|PACid:20197544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]