SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029137m|PACid:20197359 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029137m|PACid:20197359
Domain Number 1 Region: 215-316
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-20
Family B3 DNA binding domain 0.0081
Further Details:      
 
Domain Number 2 Region: 341-435
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-17
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 76-166
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-16
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029137m|PACid:20197359
Sequence length 436
Sequence
MAKSKLLHPQSFHTLVPSNNNDDEELPRKKKLKKNRLDEKVSNEEEEDMESLMEVEKKKK
QSPKPKRRAVSYASYSPCHKRLVTFTLPSDYVKISSLTLPKPFLRENGINKPEKKIYLLG
KDGTKWPTSLLKDNKGIMSLGSGWKDFVKANGLETGFTLKLMWEGTTPSFSLWSSESASD
VEEEEEFSKDPSKIEKMRQDENKKEERQRDSTPSSQKQFVTITITPDNLRKNRLRFPKQF
VKENSMNKPGMIYLLRKDGTKWMVNLVQERDGRMSLGSGWRVFAEANDLKPGESFTLEAF
FEDTTPMVRFIRTECNNSEASKKESVSKEDTETRNRNTEQFVTLTLIPDDVRACKLHLPS
QFMKANGINRLGKITLLGENKMEWPAYLLSTRDGTVALEYGWDGFCEANGVKLGEDFTLE
FIYEQGTVTVLRFCSK
Download sequence
Identical sequences V4L4F2
Thhalv10029137m|PACid:20197359 XP_006397056.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]