SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029259m|PACid:20197343 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029259m|PACid:20197343
Domain Number 1 Region: 284-406
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-16
Family B3 DNA binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029259m|PACid:20197343
Sequence length 419
Sequence
MGSRSEWKNWRYRYQPSESEADEPKLLAPKTVPFPSSRVSSLALCPVRRVLPRSDPPSLS
YRANGTASLSEELRRKGKSKCHTKKKTKTLSAKEEESDKRIFRLFPRKTRTPVFIRRNPQ
QNLNGASSWSSSFLLDPNTIPADSKTRNPQNPNGLSSSSSSSFLLDLNTIPPDDSETQNP
NGASSSSSSFFGDYKIAARSSSKMMDMRNSRNPNSQSSLSSCLTENKPHKRRATQDIKPI
GKSKKAKVATFSWIGRETPEWLTLLMKDTNETVVKWGERTDLRLIFERTLFKTDVNPGES
RLSMPFNELIQKDFLTPVEFGIIEEDINSDKKMGIGAILIDQQNVKWGVMLKRWEMKKDS
GRGSWNYALTCGWNEIVKANGLKQGDDISIWSFRWGGLLCFALVTPPPSMAQSSSSLVV
Download sequence
Identical sequences V4L4H8
XP_006397086.1.70970 Thhalv10029259m|PACid:20197343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]