SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029268m|PACid:20197469 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029268m|PACid:20197469
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000451
Family B3 DNA binding domain 0.03
Further Details:      
 
Weak hits

Sequence:  Thhalv10029268m|PACid:20197469
Domain Number - Region: 101-164
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0942
Family Pan module (APPLE domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029268m|PACid:20197469
Sequence length 166
Sequence
MAMLDQNKPWSIPIKLTASDTNSDGGGTITFPKTLLETQLFPLRGAARTKRVSHDNKEEI
VDVHDYYRDISTFLVMKKDDEGNFKLSGWGTICDRREFKEGDTIGFWWENARLNFTPLIM
SLVQPTPSKCKCKCQCKSKSKCKCKCKCYANTDANANVSSPIVLSD
Download sequence
Identical sequences V4LEJ6
Thhalv10029268m|PACid:20197469 XP_006396735.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]