SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029469m|PACid:20197619 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029469m|PACid:20197619
Domain Number 1 Region: 222-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000569
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029469m|PACid:20197619
Sequence length 353
Sequence
MYYNDHRARAKKDVTSRNSLSLVDTAVELYEEEQKSKSHTKTKTKKKTKTKTKTETDLSA
KEETEEERDRRIFHLFPKKNRNSGVNSQQNLNGASSSSSSILLDHNTIPADSETRNPQNP
NGPSPSSSSSFLFDLNTISADDSETQNPQNPNSQLSLSLSLTENKSPKKRAAQDISPSGK
SKKAKVATFSWIGKEIPERLTQLMTDKSEAVLKLGERTDLKLIFEKTLFNEDVDSTENYL
SMPSRKLIHKDFLKPFELRIVKKDINNDDYKFGIEGILFDERNVKWEAILQKFEVEKESG
RRSWNYNLTCGWNEIVKANGLKQGDNISVWSFRWGALLCFALVTPPPSLDLSL
Download sequence
Identical sequences V4LF91
Thhalv10029469m|PACid:20197619 XP_006397010.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]