SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10029471m|PACid:20197403 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10029471m|PACid:20197403
Domain Number 1 Region: 214-334
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-17
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10029471m|PACid:20197403
Sequence length 344
Sequence
MYYSDHLALAEKEITSRNLCCLVDTAVMLYEEELLRKGKSKCHTKTKSTLSAKEEESDKR
IFHLFPRKTRTSVFTRRNSQQNLNVASSSSSFLLDLTTIPADLKTRNPQNPNGASSSSSS
FLENYKIMAESKKKTEIRNQRNPNSQSSLSSCLTENKSRKRPATQDTKRCGKSMKAKVET
FSWKERETPEWLTLLMNDTNEAVLKWGERTDLRLIFEKTLFKTDVNPGESRLSMPFNELI
RKDFLTPVELRIIEEDINSDKKMGIGAILVDQRNVKWGVMLKRWEMKKDSGRGSWNYALT
CGWNDIVKANGLKQGDIISVWSFRWGGLLCFALVTPPPSIGLSL
Download sequence
Identical sequences V4KKK3
Thhalv10029471m|PACid:20197403 XP_006396952.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]