SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219871493|ref|YP_002475868.1| from Haemophilus parasuis SH0165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219871493|ref|YP_002475868.1|
Domain Number 1 Region: 533-1011
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-122
Family ALDH-like 0.000000954
Further Details:      
 
Domain Number 2 Region: 183-526
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.57e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000133
Further Details:      
 
Domain Number 3 Region: 15-182
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.89e-62
Family N-terminal domain of bifunctional PutA protein 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219871493|ref|YP_002475868.1|
Sequence length 1203
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Haemophilus parasuis SH0165]
Sequence
MSATSHYHILPQGTAIRPTLSEHYRCDEEQLVKQLIPQARVDEHAEGIKTLTKKLVEKVR
NARQKASGVDALMHEFSLSSEEGVALMCLAEALLRIPDKATADKLIRDKIAKGDWRSHVG
NSPSLFVNAAAWGLVVTGKLVATHSESSLASSLSRLIQKGGEPLIRKGVDVAMRLLGKQF
VTGETIQQAIKNGEKRFAMGYRYSYDMLGEAAFTEQDAKRYYDDYVASIHAVGAVSRGLG
VYKSSGVSVKLSAIHPRYSLAQHKRVIDELYPRLKDLFLLAKQYDIGLNIDAEEADRLEL
SLDLMDRLIADPDLADFAGIGFVVQAYQKRCPYVIDYLIEKARANHRKLMIRLVKGAYWD
SEVKRAQADGAEGYPVFSRKVHTDLNYVVCAKKLLSAQDVIYPQFATHNAQTLSTIYHLA
QGKHFEFQCLHGMGETLYDEVVGSHNLNVQCRIYAPVGSYQTLLAYLVRRLLENGANSSF
VNQIVDENLSIDDLACDPVAKAQITEGTMHPKIPLPVKLFAEQRQNSKGYDLTDAIHLKT
LEAELNQLASRQYRAEPQIAGEKTENLHSRQVHNPANIAEVVGEVIEATENDVAKAFAVA
EQFKAEWQNTSPIVRAEALEKMADLMEANMPQLFDLAVREAGKTLNNAIAEVREAVDFCR
YYAKEVRQNPEGYRNPRGIVVAISPWNFPLAIFVGEVSSALVAGNVVLAKPAEQTSLMAY
YAVSLFHQAGIPEQALQCLTGSGKVIGSALVSDPRVNGVIFTGSTDTAKNINRNLQKSAH
IVPLIAETGGQNAMIVDSSALAEQVVADILNSAFDSAGQRCSALRVLYLQRDVAEHILTM
LKGAMAELKVGRPQNLNTDVGPVIDKVAQERLLNHIDEMKKVAKSCYQVPIDPELSQTGI
FVPPTLLEIEHINQLKHEVFGPVLHVIRFDADNLPQVMADINSTGFGLTSGLHSRIDETV
DLWLESIYAGNLYVNRNTVGAVVGVQPFGGMGLSGTGPKAGGPLYLQRLVNRCEWTLSGL
EGGKPADTSGLLTGIQAVLSGTELQNAQDLIASLSRQSPLGKVFKMQGITGEVNFMQFEA
RPVIAIGNGSLEQQIQALIAVVVSGSRAVVHSNSPLAKQAQHFAGLVIISNDFNSLANLS
SLIVLEPLSLEEKAHYAERTGAILTYVENLDLALSLFPLLHEKAISINTAAAGGNASLMS
EMD
Download sequence
Identical sequences B8F6G8
gi|219871493|ref|YP_002475868.1| 557723.HAPS_1340 WP_015939731.1.69939 WP_015939731.1.83421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]