SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219872277|ref|YP_002476652.1| from Haemophilus parasuis SH0165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219872277|ref|YP_002476652.1|
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.88e-93
Family Methylenetetrahydrofolate reductase 0.00000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219872277|ref|YP_002476652.1|
Sequence length 293
Comment 5,10-methylenetetrahydrofolate reductase [Haemophilus parasuis SH0165]
Sequence
MSYAKEIDLLNQSVADLNGKINVSFEFFPPKNEKMETLLWDSIHRLKVLKPKFVSVTYGA
NSGERNRTHSIVKTIQQETGIVAAPHLTGIDAPLDELRAIAKDYWDSGIRHIVALRGDEP
AGYTKKPFYASDLVKLLKEVADFEISVAAYPEVHPEAKSAQSDLLYLKQKVDAGASRAIT
QFFFDIDSYLRFRDRCATVGIDVEIVPGILPVSNFKQLEKMAKITNVKIPSWMAKMYQGL
DDDQTTRNLVGASIAMDMVKILSKEGVKDFHFYTLNRSELSYAICHTLGVRPE
Download sequence
Identical sequences B8F8Q2
WP_015940151.1.19398 WP_015940151.1.83421 WP_015940151.1.9017 gi|219872277|ref|YP_002476652.1| 557723.HAPS_2275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]