SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218675803|ref|YP_002394622.1| from Vibrio splendidus LGP32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218675803|ref|YP_002394622.1|
Domain Number 1 Region: 561-1042
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-126
Family ALDH-like 0.000000409
Further Details:      
 
Domain Number 2 Region: 189-538
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.02e-111
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000503
Further Details:      
 
Domain Number 3 Region: 19-188
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.44e-63
Family N-terminal domain of bifunctional PutA protein 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218675803|ref|YP_002394622.1|
Sequence length 1051
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Vibrio splendidus LGP32]
Sequence
MFTATDVLKPEFNEQSLADLWSLISPLYMVDETQWLEQLLPLATPSESEKQQITDKTTSL
IEAIRADKTSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDSATADALIRDKLSVADW
KSHLKNSDSVFVNASTWGLMLTGKVVGLSSKEQSAGQAVNRLVNKLSEPVIRKAMHQAMK
VMGHQFVLGRSIAEAQKNGKSMRDKGFTYSYDMLGEAALTTADANKYFKDYLMAIEAVGR
DNYVSPQSKVSSKSSPAPSVSIKLSALHPRYEVANEERVLTELCDTLEQLLRRAVELDVA
ITIDAEEADRLELSLKLFEKLYRTDLVKGWGKFGLVIQAYSKRALPVLVWLNRLAKEQGD
LIPLRLVKGAYWDSEIKWSQQAGFTDYPVYTRKEATDVAYLACARYLLSPSVRGNIFPQF
ASHNAHTVSAIAVMTDHKDFEFQRLHGMGDSLYNHAMEAYQQSVRIYAPVGSHKDLLPYL
VRRLLENGANSSFVHRLVDARCPVAELTQHPVDMLLAFDTLHNTKIPLPPAVFPERKNSY
GVNIDIESEAHQFEEQVKGFLNNQWTAGPVINGESLAESMIKADQNVEQVTAPYDRRINV
GQVAFANLDHVSAAITGADAAFADWNATSVETKAAALDKLADLMEDNLAELVAICHQEAG
KTIHDSVDEVREAVDFCRYYAKQADNLQGFELKGFDGQTRIASRQGRGVFVCISPWNFPL
AIFLGQITAALVAGNTVVAKPAEQTSLIAARAVELMNEAGFPAGTIQLLPGRGAEIGSAL
TSHDAIAGVAFTGSTPTAQRINVSLATRNAKPVPFIAETGGQNAMIVDSTALPEQVVRDV
IRSAFASAGQRCSALRVLYIQEDIADRVVGLIHGAMDELSVGIPHLHKTDVGPVIDQNAK
QKLMAHLENMTNTQKKVAQLSLGSDCEHGDFVPPSAFEIDDISCLKEEQFGPVLHIVRFK
ASELAQVVDQINQTGFGLTMGIHSRNETTYRWIEKHVRVGNCYINRDQVGAVVGVQPFGG
QGLSGTGPKAGGPHYLYRFTDVHFSQSQDKA
Download sequence
Identical sequences B7VPZ0
gi|218675803|ref|YP_002394622.1| 575788.VS_II0019 WP_012600036.1.409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]