SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218675981|ref|YP_002394800.1| from Vibrio splendidus LGP32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218675981|ref|YP_002394800.1|
Domain Number 1 Region: 40-109
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.000000000000536
Family Outer membrane lipoprotein 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218675981|ref|YP_002394800.1|
Sequence length 110
Comment outer membrane lipoprotein [Vibrio splendidus LGP32]
Sequence
MKRLYDKECIAHLLMINKQGVLMNKTLIAAAASVFILAGCSSEPEEAAMSQMDQLTNQVA
ELTSEVEALKGDKAAAEMKAQEAAAAAMAAKEEADRANDRIDNIAESYTK
Download sequence
Identical sequences B7VQG8
gi|218675981|ref|YP_002394800.1| 575788.VS_II0199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]