SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218708098|ref|YP_002415719.1| from Vibrio splendidus LGP32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218708098|ref|YP_002415719.1|
Domain Number 1 Region: 138-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-44
Family Extended AAA-ATPase domain 0.00000739
Further Details:      
 
Domain Number 2 Region: 369-472
Classification Level Classification E-value
Superfamily TrpR-like 1.31e-37
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218708098|ref|YP_002415719.1|
Sequence length 473
Comment chromosomal replication initiation protein [Vibrio splendidus LGP32]
Sequence
MSSSLWLQCLQQLQEELPATEFSMWVRPLQAELNGNTLTLFAPNRFVLDWVRDKYLNSIN
RLLQEYCGNDIPHLHFEIGNKRVTAPKSETIAPARTRTAADVAAESSAPAQLQARKPVHN
IWRDEEPVAVDLNHRSNVNPKHKFNNFVEGKSNQLGLAAARQVSDNPGTAYNPLFLYGGT
GLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLI
DDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAI
EPPELETRVAILMKKAEDHQIHLADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPI
TIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALA
KELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYSNLIRTLSS
Download sequence
Identical sequences A0A1C3IJ87 A0A1E5EMT5 B7VGI4
gi|218708098|ref|YP_002415719.1| WP_009848136.1.30411 WP_009848136.1.40033 WP_009848136.1.409 WP_009848136.1.49583 WP_009848136.1.99591 575788.VS_0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]