SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384049854|ref|YP_005476917.1| from Acetobacter pasteurianus IFO 3283-03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384049854|ref|YP_005476917.1|
Domain Number 1 Region: 34-342
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-90
Family Phosphate binding protein-like 0.0000000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384049854|ref|YP_005476917.1|
Sequence length 344
Comment phosphate-binding periplasmic protein [Acetobacter pasteurianus IFO 3283-03]
Sequence
MLPKMRFSFRSETCAAAVACLLAAVPSFSHAQSVTGAGSSFAAPIYEAWASAAKADTGVN
VNYQTVGSSAGQNQILAGTVDFGASDAPMDAKKLESAHLFQFPTVMGGIVPVVNIPGIKA
DVLVLSGDVLASIYSGDITSWNDPKIAALNPGVSLPDTAVAPIHRADGSGTTFVFTSYLD
QSSKNWHDQYGAGTSISWPGGLGARGNDGVSATVQNTEGGVGYVEYAYASRNHLTTIRLK
NSSGQAVAASQASFSQAAEAADWKNASHFSVNLLNTSGAQAWPIVSATYVLVPLPARNPA
RDEAVKRFFIWDFAKGDSIAAKLDYVPLPKAVKDSIQSAWQAGK
Download sequence
Identical sequences C7JCL8 H1UQK6
gi|384052964|ref|YP_005486058.1| WP_003623764.1.13261 WP_003623764.1.36695 WP_003623764.1.36696 WP_003623764.1.37930 WP_003623764.1.38618 WP_003623764.1.45580 WP_003623764.1.55019 WP_003623764.1.62313 WP_003623764.1.64431 WP_003623764.1.65311 WP_003623764.1.71918 WP_003623764.1.82089 WP_003623764.1.88241 WP_003623764.1.96488 WP_003623764.1.99323 gi|384056196|ref|YP_005488863.1| gi|384041339|ref|YP_005480083.1| gi|384049854|ref|YP_005476917.1| gi|258541418|ref|YP_003186851.1| gi|384118207|ref|YP_005500831.1| 634452.APA01_03190 gi|384062131|ref|YP_005482773.1| gi|384058837|ref|YP_005497965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]