SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384050898|ref|YP_005477961.1| from Acetobacter pasteurianus IFO 3283-03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384050898|ref|YP_005477961.1|
Domain Number 1 Region: 32-263
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-42
Family Phosphate binding protein-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384050898|ref|YP_005477961.1|
Sequence length 316
Comment aliphatic sulfonate transporter substrate-binding periplasmic protein [Acetobacter pasteurianus IFO 3283-03]
Sequence
MLSRRKFGKNILSQLVGISLASTLGGRAFAQQQSIRIGYQKYGTLALLKDQKILEKSLDP
KGISVQWALFPAGPPLLQALIAGALDFGSAGDLPPIFAQASSPGSMVYVGHETPAGASEA
IIVPQNSAITTIKDLQGKSIAVTRGSDAHWLLLAALKNNGLSLNDVKVSYLLPAAARPAF
EGGKVDAWAIWDPYLSGVSSPVRVLATGEDVQGGTEFYLASKEFYQKSPELLDEVTNAIA
QCDIWMESHKAEVAAILAHSTGLELDVVMRSIAKIHYGYHPITHPVIASQQHIADTFAAA
GLLPSAPNVQDAAPEI
Download sequence
Identical sequences C7JHQ9 S6D583
gi|384042381|ref|YP_005481125.1| gi|258542460|ref|YP_003187893.1| 634452.APA01_13670 gi|384054006|ref|YP_005487100.1| WP_004449388.1.36695 WP_004449388.1.37930 WP_004449388.1.38618 WP_004449388.1.45580 WP_004449388.1.55019 WP_004449388.1.62313 WP_004449388.1.64431 WP_004449388.1.65311 WP_004449388.1.71918 WP_004449388.1.88241 WP_004449388.1.96488 WP_004449388.1.99323 gi|384057240|ref|YP_005489907.1| gi|384059881|ref|YP_005499009.1| gi|529230219|ref|YP_008391034.1| gi|384119249|ref|YP_005501873.1| gi|384063173|ref|YP_005483815.1| gi|384050898|ref|YP_005477961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]