SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384051496|ref|YP_005478559.1| from Acetobacter pasteurianus IFO 3283-03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384051496|ref|YP_005478559.1|
Domain Number 1 Region: 30-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.99e-58
Family Phosphate binding protein-like 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384051496|ref|YP_005478559.1|
Sequence length 253
Comment ATP phosphoribosyltransferase [Acetobacter pasteurianus IFO 3283-03]
Sequence
MTRLASAGVFMNHPRPAHQTETSFGTEDNGRIVLALPKGRILKAVSPLMSGTGMAPAPEC
LGGDSRKLRFPTQDPQVDVVRVRSFDVATFVASGGAQVGVCGADVLMEFDYPEIYAPLDL
GIGACRISVAQPAHLPHDPQEWKRWSEVRVATKYPAITRRFFAARGINATIVHLHGAMEL
APMLGLSRLIVDLVDTGSTLKANGLKEVETIAQVTSRVIVNRTALKTRPEQIDRILSRFR
TALAASSPVAENV
Download sequence
Identical sequences C7JD99 H1UMF8
gi|384057838|ref|YP_005490505.1| gi|384060479|ref|YP_005499607.1| gi|384119780|ref|YP_005502404.1| gi|258543057|ref|YP_003188490.1| gi|384042979|ref|YP_005481723.1| 634452.APA01_19880 gi|384063771|ref|YP_005484413.1| gi|384051496|ref|YP_005478559.1| gi|384054603|ref|YP_005487697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]