SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384051691|ref|YP_005478754.1| from Acetobacter pasteurianus IFO 3283-03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384051691|ref|YP_005478754.1|
Domain Number 1 Region: 33-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.6e-74
Family Phosphate binding protein-like 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384051691|ref|YP_005478754.1|
Sequence length 270
Comment D-methionine transporter substrate-binding periplasmic protein [Acetobacter pasteurianus IFO 3283-03]
Sequence
MSSSFLSRRVMLAGMGVAMMAPYGVARADGQVLRIGIIAGEDEDVWRVVAENAAKEGLTL
KIIPFSDYNAPNEALAEHELDANAFQHGPFLEAQNKAKNFHIVPVGNTYLSPIGLYSRRW
KSVAELPNKAVIGVPNDPTNEGRALLLLQKLGLIKVAEDAGLVPTALDITENPRQISVKE
MDAGMVGRALPDMDAAVVNTDWANKAGIDLQKERIAQEAPQNNPYVCFIAVNETDKNAPW
VSKLVSAFQQDNVKQALAQAFHGAVVPGWS
Download sequence
Identical sequences C7JEC4
gi|384058033|ref|YP_005490700.1| gi|384054798|ref|YP_005487892.1| gi|384063966|ref|YP_005484608.1| gi|384060674|ref|YP_005499802.1| gi|258543254|ref|YP_003188687.1| 634452.APA01_21920 gi|384119977|ref|YP_005502601.1| WP_014457346.1.36695 WP_014457346.1.38618 WP_014457346.1.45580 WP_014457346.1.55019 WP_014457346.1.65311 WP_014457346.1.71918 WP_014457346.1.88241 WP_014457346.1.96488 WP_014457346.1.99323 gi|384051691|ref|YP_005478754.1| gi|384043174|ref|YP_005481918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]