SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218231387|ref|YP_002369286.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218231387|ref|YP_002369286.1|
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.94e-44
Family YfcE-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218231387|ref|YP_002369286.1|
Sequence length 167
Comment phosphoesterase [Bacillus cereus B4264]
Sequence
MKALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGDSELTSAHEELQGFHVVKGNCDYANF
QDEIVTDVDGIRFLVVHGHRHNVKMTLQTLAYHAEEVGAQVACFGHSHVLGAELIEGVLF
INPGSILLPRQRVEKTFALLEMDENQMEVRFETLDGQLVEQAVFKRG
Download sequence
Identical sequences A0A0J6Z5N2 A0A1J9TRL3 A0A243DE92 A0A243HIE4 A0A2J9D9Y0 B7HEB1 N1LLL3
WP_000645511.1.100082 WP_000645511.1.10055 WP_000645511.1.10584 WP_000645511.1.14039 WP_000645511.1.22991 WP_000645511.1.23652 WP_000645511.1.35153 WP_000645511.1.3798 WP_000645511.1.39957 WP_000645511.1.45317 WP_000645511.1.47975 WP_000645511.1.60334 WP_000645511.1.63902 WP_000645511.1.67873 WP_000645511.1.73457 WP_000645511.1.73594 WP_000645511.1.7593 WP_000645511.1.76086 WP_000645511.1.81773 WP_000645511.1.83228 WP_000645511.1.85348 WP_000645511.1.86619 WP_000645511.1.90352 WP_000645511.1.95576 WP_000645511.1.96287 WP_000645511.1.97670 WP_000645511.1.99212 405532.BCB4264_A4599 gi|218231387|ref|YP_002369286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]