SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218231424|ref|YP_002368927.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218231424|ref|YP_002368927.1|
Domain Number 1 Region: 36-371
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.46e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 373-611
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.35e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218231424|ref|YP_002368927.1|
Sequence length 786
Comment bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein [Bacillus cereus B4264]
Sequence
MKKSKKMLAGATLAIGVIAPQVMPTTAHADENTGESTVNLRILETSDIHVNLMNYDYYQT
KTDNKVGLVQTATLVNKAREEAKNSVLFDDGDALQGTPLGDYVANKIKDPKNPVDPSYTH
PLYRVMNLMKYDVISLGNHEFNYGLDYLNKVIEKTDFPVINSNVYKDDHDDKEENDENYF
KPYHILKKEVVDEAGQKQIVKIGVMGFVPPQIMNWDKANLEGKVKAKDIVATARIMVKKM
QDEGADIIVALAHSGVDKSEYKEANKMENASYHLATQVPGVDAVLMGHSHTEVKDVFNGV
PVVMPGVFGSNLGIIDMQLKKVNGKWEVQKDQSKPQLRPIANSKGTPLVESDQKLVNEIK
DEHQATIDYVNTPVGETKAPINSYFSLVQDDPSVQIVTNAQKWYVEQELKKPEYEKIKDI
PVLSAGAPFKAGGRNGATYYTDIPAGTLAIKNVADLYVYPNTLYAVKVNGAQVKEWLEMS
AGQFNQIDPTKTEEQPLVNIGYPTYNFDILDGLKYEIDVTQPAKYDKDGKVVNANANRIV
NMTYEGKPVADNQEFIVATNNYRGSSKTFPGVSEGEVIYQSQDETRQIIVKYMQETPVIN
PTADKNWTFKPIVADKLITTFDSSPNAQNYIKKDGKISYVGPSENEFAKYAIDITKKNDD
KETGGENPTTPPTGGGENPTTPPTGGGENPTTPPTGNGENPTPPTEEGNNGNEPKQDGNN
TGSGQTTTDDQNTKETTTTVSENKEAEKDERDLPKTGASIASTIGAGLAFVGAGLLMLFR
RKKANR
Download sequence
Identical sequences B7HAZ5
405532.BCB4264_A4233 WP_000748655.1.76086 gi|218231424|ref|YP_002368927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]