SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218232119|ref|YP_002365603.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218232119|ref|YP_002365603.1|
Domain Number 1 Region: 47-310
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.01e-36
Family GpdQ-like 0.0074
Further Details:      
 
Domain Number 2 Region: 452-654
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.47e-27
Family Trypanosoma sialidase, C-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 344-443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000415
Family Fibronectin type III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218232119|ref|YP_002365603.1|
Sequence length 819
Comment purple acid phosphatase/fibronectin domain protein [Bacillus cereus B4264]
Sequence
MDRNALRKVKGLIGLLMVFVLAFVSFPWSTSVKAEEKKQERASSEKKIVFPVVSDVHIKN
SGTDDTFRWKRAIEQFNTLAPKQDAFVIVGDFTDTGSVQQYDRFMQVYNENANKDAVRMN
SLGNHDYWNGLSVEGAQKRFLEKTGMESIYYHKVVKGYHFLVMSPENGTTHGYYSDKQIN
WLKEEMVKAQKDDPEKPIFVFLHQHIKDTVYGSQEWGTQDSAKINAVLKEYPQVITFSGH
SHYPLDDPRSIHQKDFTSVGTSSVSYMEVEGGKVQGNIPPGASTLSQGLLVEVDEEEVTI
NRRDFHTNSWTGEPWKIKLPAKKETFTHVEDRDKEKPYFAKDAKLTVSNVTANAATVTFP
QALDNLLVHSYRVQARDKQTGEIKNKLLAFSEFYRDPVPKDLTFTLAGLDGGKTYTLEVV
AIDSFGNESAQPLTAEITTKKDDIDPNVKVPKADVFDVNFADGTFKDNSPFGTKGDVKGN
VTIEYDKALKKNVMKLNGQSNTFGYLPFSAAQKEKVANTFTLETVFSMNQIRGQGILQNT
ESGGIGFESTGSGYVELWAHIGGSYKRVGVQLEANKTYHLTGTYNGSEVAIYVDGKKVNS
QPATGKVYHPNVPFALGADPDSNGNGGIPLNGKIALAKLYSKALSSSEVLAAYNEFSNRT
KLEQVNALFEELGKVKEVLAGTYEFGDKPGQYSKEAFQELEKSYNNAKQVFENVASNGEQ
IVQAYNELKTANQTFIQSKVVEQPKTLKEKLQIHIESAKVVVKKAQAANVTDGSVKALSQ
KITVAEAVVKDVKVKDTQVETMNRTMEYAISLVEKSINK
Download sequence
Identical sequences B7HEQ7
gi|218232119|ref|YP_002365603.1| 405532.BCB4264_A0869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]