SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218232357|ref|YP_002367773.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218232357|ref|YP_002367773.1|
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.25e-52
Family Phosphoesterase-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218232357|ref|YP_002367773.1|
Sequence length 247
Comment phosphatase [Bacillus cereus B4264]
Sequence
MNKIAVISDIHGNIQALESVLNDIKLRGIERIICLGDLVGKGPHSSEAIEIIRKECEVVV
MGNWDDFITKPTEFEALKWHQKQLSEEQNDYLRSLPFSIEFYMSGKLIRMFHASPRSLYE
RIQPHASREERISMFENSDLTENIEGERKPDVVCYGDVHQAFVQNFRGKTLCNAGSVGNP
LEITQASYLIFEGTYNEKEAASFSIQLVRVPYDIELAIRLAEELEMPEIEEYKQELRTAL
YRGFKGK
Download sequence
Identical sequences B7H8F6
gi|218232357|ref|YP_002367773.1| WP_001033081.1.76086 405532.BCB4264_A3065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]