SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218232451|ref|YP_002366794.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218232451|ref|YP_002366794.1|
Domain Number 1 Region: 9-225
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.69e-34
Family YfcE-like 0.063
Further Details:      
 
Weak hits

Sequence:  gi|218232451|ref|YP_002366794.1|
Domain Number - Region: 327-367
Classification Level Classification E-value
Superfamily SH3-domain 0.00354
Family SH3-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218232451|ref|YP_002366794.1|
Sequence length 375
Comment serine/threonine protein phosphatase [Bacillus cereus B4264]
Sequence
MKKIKKLSIPNDARVIVISDIHGELNLLKEALHKVNFKDEDYLIINGDLCEKGRDSVGVV
NYVMNLVKNNSKVHVVEGNCEVLVDALLNENPDLINYLCMRKHSIFNEWLERLGFSVHEG
TSIREVKEALLSEFSQELYWLTELPTAIETEDYIFVHAGLEDRVDWKETERKNAIAMPQF
FNKSHKANKYVIVGHWPVVNYSEEAPSNNPVIDKEKKIIAIDGGNAIKEAGQLNVFIIQR
KQTGDTFSYTYVDYFPEYEVIADFNANSEMQGGVTYPYYYIEPIEKMQDYTVCRQKETNN
LLTVKNEYMKQLESGEYTVKTDISCAQISVRKGDIVSLIDDSCSGYDLIKKDGVEGWIGK
GILVEIEKVKNKTLS
Download sequence
Identical sequences B7HJT7
405532.BCB4264_A2077 gi|218232451|ref|YP_002366794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]