SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218233086|ref|YP_002365783.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218233086|ref|YP_002365783.1|
Domain Number 1 Region: 5-300
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.66e-58
Family DNA double-strand break repair nuclease 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218233086|ref|YP_002365783.1|
Sequence length 413
Comment DNA repair exonuclease [Bacillus cereus B4264]
Sequence
MKQVKFIHAADLHLDSPFKGMEMNVAQSVWERMKQSTFESFERIIDKAIQERVDFVLLAG
DLYDGETRSLRAQVFVREQMKRLSQYDIPVFIIHGNHDHLGGSWAAIEFPENVHVFTEPY
VEEKSFYKNGELLASIYGFSYLQQAVTDNMTAQYTKMSDAPFHIGMLHGSVEGDAEHNRY
APFQIRELKEKQFDYWALGHIHKREILSEEPCIIYPGNIQGRHRKETGEKGAYLIELTKQ
GKQCSFFHTADVVWDEIEVCIDRLETVDELMTSLSTAMNECRREEEGTLLTVVFTGQGPL
SPYLRDEKRVEEIFHILASGEERKDFVYAMKWKNETVSFAEIERLKAENHFVGSVLKELE
AFSNMDGVLRTIWTSPVARNSIESFTEEEKKEIQKEAENIILEQLFQQERDKK
Download sequence
Identical sequences B7HFY8 C2R4G6
405532.BCB4264_A1050 gi|218233086|ref|YP_002365783.1| WP_000815690.1.60334 WP_000815690.1.73594 WP_000815690.1.76086 WP_000815690.1.76804 WP_000815690.1.95576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]