SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218233796|ref|YP_002367042.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218233796|ref|YP_002367042.1|
Domain Number 1 Region: 1-318
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.2e-53
Family DNA double-strand break repair nuclease 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218233796|ref|YP_002367042.1|
Sequence length 385
Comment exonuclease SbcD [Bacillus cereus B4264]
Sequence
MKLFHTADWHLGKLVHGVYMTEDQKIVLDQFVQAVEEEKPDAVIIAGDLYDRAIPPTEAV
DLLNDVLQKIVIDLQTPVIAVAGNHDSPDRIHFGSSLMKKQGLHIAGQFQFPYEPVVLND
EYGEVHFHLIPYADPSIVRHVLKNEDVRSHDDAMRIFMNELSETMDKEARHVFVGHAFVT
SSGEAEENTSDAERPLSIGGAEYINSHYFDKFHYTALGHLHQAHFVRNETIRYSGSPLAY
SISEEKHKKGYYIVELNETGEVAIEKRLLSPRRKMRTVEAKIDELLQHPVSEDYVFVKLL
DENPVLQPMEKIRSVYPNAMHVERAMQRRELTDTNEVTVSRHKTDDLSLLKAFYKEMKGL
DLSEEKERLFIDVLQTVQEREGERG
Download sequence
Identical sequences B7H5A2
WP_000765147.1.76086 gi|218233796|ref|YP_002367042.1| 405532.BCB4264_A2325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]