SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218233953|ref|YP_002368500.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218233953|ref|YP_002368500.1|
Domain Number 1 Region: 2-317
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.01e-83
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 315-526
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 6.41e-51
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218233953|ref|YP_002368500.1|
Sequence length 527
Comment 5'-nucleotidase [Bacillus cereus B4264]
Sequence
MEQNQTVTLNILLTSDIHGTVYPIHYQDNSPAELGLAKISTLIKKERSQNTNVLLIDNGD
FIQGTPFTYHYVTYEKNKKNPMSLLANYLQYDAAIIGNHEFNYGMDILNNAVTTANFPYL
SANILDKNIKKPYFGKPYIIKQIESNIKIAILGVTTHYITNWEQPHHIKDLQFEDALETT
KKWVSYIRKHEKPDLLVVAYHGGVERDLQTGVPTEVLTGENQGYAMCHEIEDIDILLTGH
QHREIAHTMANGVTILQTGCNGNLVGKVKITFEKTKHKWVKKESSSELLSVQGVEADQDA
LSLVADYEEKTQKWLDQPIGIIQGDMQISDAMQTRLHDHPFIEFINKIQMDIANVSISCT
SLFHNTSPGFPEHVTMRDIVSNYIYPNTLKVIRLTGADIKNALELSASYFTLKTDGSITV
SPTYIEPKPQHYNYDMWEGISYVLNISKPIGERVESLQHNSAPLNMNEEYDVVMNNYRAS
GGGNFFMFQNKPVVKDIPTDMSELIANYILEHKTIEATVNNNWKVIK
Download sequence
Identical sequences B7HCG6
WP_000437448.1.7593 WP_000437448.1.76086 405532.BCB4264_A3796 gi|218233953|ref|YP_002368500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]