SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218233988|ref|YP_002367451.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218233988|ref|YP_002367451.1|
Domain Number 1 Region: 32-343
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.6e-75
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 356-569
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.03e-26
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218233988|ref|YP_002367451.1|
Sequence length 652
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [Bacillus cereus B4264]
Sequence
MQKMKWKNYVCYFVILLLLGTAVIVKPSISKAEESEVNITLLGTADIHGRFMPWDYALDG
ANMSGSLTQLYTVIKKVRQENPNTILVDAGDTIQGNSVELFNDKPQSPMMVAMNTMGYDA
WAFGNHEFNFGLDTLKKVSAQYKGKTLAGNIYKENGERFLPAYTIVEKGGIKVGIIGMNT
PMISDFEKGTDHLDGLVVKNPVEETKKAIKELEGKVDVMVGVMHMGLENENGIPGTGVQD
IANACPELSAIFAAHMHKLVKKEVVNGVIITEPDKYGTHISRIDLTFTKQDGKLALKNKT
ATAIPVKNADGTTILSDPTLEETLTPFHEYARGDANVVVAQLKGRNLVPENEIKGIPSVQ
IQETPLSDFFHEVMLYYSKADVVAHQIDNDYARLDIGPIKKKDIAYNYQYALGEITVYKI
SGKDLKDYMEWAAGYFNSSRAGDVTVSFDKTRRASKYSTNDFFGGVKYEIDLTKPYGSRI
TNLRSIRTNKPIKMSDAMTLGMNAYRMEALQAKGGALEGRKFEQIWSSKQENAFGETGGT
IRNLAITYLKEVKNGVYTPKVMRNWKITGVDLHSSEHKAVVDLVNKGILEIPKTEDGKYT
NIASINTKDSISKEEIILLSQKANINPNQFNHVKTKGEFYKKLSRITKKYKL
Download sequence
Identical sequences B7H865
gi|218233988|ref|YP_002367451.1| 405532.BCB4264_A2743 WP_001171084.1.7593 WP_001171084.1.76086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]