SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218234184|ref|YP_002367942.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218234184|ref|YP_002367942.1|
Domain Number 1 Region: 34-321
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.6e-33
Family GpdQ-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218234184|ref|YP_002367942.1|
Sequence length 410
Comment hypothetical protein BCB4264_A3236 [Bacillus cereus B4264]
Sequence
MKKTVASLAVMAALLPTFSVHAEGKEQARKSATTFNVISDVQGDLGDFDHVLKDMNKVTP
LSRALIMNGDITPTGQQSQYDDVKRVLNKNKHPENVWSTVGNHEFYAGKWTADGKLSQST
WPNGVTEETLFNRYLKFSGQEKVYHKKELDGYPLLFLGTEKYMKYHDSKMWDEVYMSDEQ
LGWLKQNLEEYSQKDKNKPIFIFSHHVLPDTVSGSRQSPYLQDYLNVDKLYDILKDYPQV
VFFTSHTHWDLNLPDWAGKKKIAGGDKKGFTVVNTGGIETGWMSAGPNGGEKTAPDGYSF
KQGLQVKAYGNDVIVTAYDYKRDKDIKKLLISDSKIAQMAPNVTADDSKNIIVGATEYME
YTIEGTNEWHTYSKANPPKFDGDKVVYVRHKGEMNLEPGLTQLLRFSVNK
Download sequence
Identical sequences B7HBX6
WP_000754293.1.76086 405532.BCB4264_A3236 gi|218234184|ref|YP_002367942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]