SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218234384|ref|YP_002368905.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218234384|ref|YP_002368905.1|
Domain Number 1 Region: 33-341
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.51e-81
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 339-528
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.7e-56
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218234384|ref|YP_002368905.1|
Sequence length 529
Comment 5'-nucleotidase [Bacillus cereus B4264]
Sequence
MWKKIIPAVAVLSTITFSSVFAAPPSQNPAEQNRYIDVQMLGINDLHGQLDTVKKINNKE
AGGADYLATYLKEHKKQNPNTLLVHAGDIVGASPPVSALLQDEPTIEFLNDLKFDVGTIG
NHEFDEGIDEMKRLIYGGYHEKTGNFKGANFPYVAANFYNKSTGRLFLPPFTVKMVDGVP
VGFIGVVTTDTPNVVMPTMLNNVQITDEVEAINKSTQQLKRLGVKSIVVLAHVGGTTDES
GVTNGDLTRIANETDPEVDVIFGGHSHTYVNGTVNNKLIVQANSYGMAFSDVDVTIDRKT
KDIVKKKAEVVTTYHEGVEPDKQVKKKLDQYKEKIAPLVNEVVGKSTAPIDRKQNDAGES
TLGNLVADAQRQTMQTQISLMNPGGIRNDLDAGDITWGELYGIQPFGNQLIKVNLTGQDI
RDILNQQWQKGTTRMLQISGIQYTWDANKPNGEKVTNIRLTNGEELSPSTTYSVVANAFL
ASGGDGFVSFKNGKNAETGPNDFEALVNYVKQLKEPIQPVIDGRIQKVN
Download sequence
Identical sequences A0A0J6NBI7 A0A243DFN1 A0A243HF94 B7H992 C2RCP2 C2T5K6 N1LMI5 Q818Y6 R8TFY1
226900.BC4100 405532.BCB4264_A4210 gi|30022187|ref|NP_833818.1| NP_833818.1.86172 WP_000265553.1.10584 WP_000265553.1.14039 WP_000265553.1.26637 WP_000265553.1.3798 WP_000265553.1.39957 WP_000265553.1.45317 WP_000265553.1.47975 WP_000265553.1.58822 WP_000265553.1.63902 WP_000265553.1.67873 WP_000265553.1.73457 WP_000265553.1.7593 WP_000265553.1.76086 WP_000265553.1.76804 WP_000265553.1.76902 WP_000265553.1.80649 WP_000265553.1.81773 WP_000265553.1.85348 WP_000265553.1.87768 WP_000265553.1.97670 WP_000265553.1.97842 gi|218234384|ref|YP_002368905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]