SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218235021|ref|YP_002368580.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218235021|ref|YP_002368580.1|
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.3e-90
Family DR1281-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218235021|ref|YP_002368580.1|
Sequence length 264
Comment phosphoesterase [Bacillus cereus B4264]
Sequence
MRILFVGDVVGSPGRGMIQQYVPALKKKYTPTVTIINGENAAGGRGITEKIYRNFLECGA
QAVTLGNHAWDNREVFEFIDDAKYLARPANFPEGTPGKGLIFVNCNGTEVAVINLQGRTF
LPPIDCPFRKVDELINIAKKRTNIIFVDFHAETTSEKQALGWYVDGRATAVVGTHTHVPT
ADNRILPSGTAYITDVGMTGPYDGILGMDREAVLKKFLTNLPVRFEVTNGRTQLSAVLID
VDPNTGKAKKIERILINDDQPFFE
Download sequence
Identical sequences A0A023PAT3 A0A063CGR2 A0A090YT61 A0A0B6BDY4 A0A0D1PFU2 A0A0E8TGB9 A0A0F5RND1 A0A0F6J144 A0A0G4CYR7 A0A0J1I0J6 A0A0K0SC29 A0A0K6N385 A0A0W7XX71 A0A154AV30 A0A158RNV3 A0A193CVU6 A0A1G1UR84 A0A1J9T4Y4 A0A1J9YRT2 A0A1J9ZPQ1 A0A1M6LXI4 A0A1Q9KHN0 A0A1W2GIA5 A0A226QU97 A0A229MDM4 A0A229MRJ4 A0A242W9I4 A0A242YTS6 A0A242ZFY9 A0A243A8M6 A0A243BAH4 A0A243BWP9 A0A243CDK2 A0A243CQ57 A0A243DE69 A0A243DS27 A0A243ES11 A0A243HE69 A0A243I2U7 A0A243IVU6 A0A243KXF3 A0A243MBF1 A0A243NQW1 A0A246UP79 A0A2B4EVG0 A0A2C9Z457 A0A2C9Z815 A0A2C9ZGW0 A0A2K1S3R6 A0RHE9 B3Z5R9 B3ZMT8 B5UWT7 B7HDQ2 B7HLB1 B7JJ55 B9IV67 C2MPA8 C2N4S0 C2NLI2 C2P2C2 C2QWV0 C2RBX3 C2S7H4 C2T4N1 C2TK98 C2UHP7 C2VXI8 C2WAS0 C2WRF5 C3C689 C3E721 C3G6S8 C3GMN2 C3H4T9 F0PPL0 G9Q3A8 J7YJL0 J8F8A9 J8GVC1 J8J2L8 J8J7C3 J8LJD5 J8LRT9 J8ME34 J8N7V5 M1QD02 N1M0F7 Q636P9 Q6HF38 Q732U8 Q81A18 R8DZN2 R8E7D2 R8FFF4 R8G178 R8GB58 R8H1V1 R8K323 R8TI23 V5MDI4 W8YFS3
gi|118478998|ref|YP_896149.1| gi|52141711|ref|YP_085118.1| gi|30021869|ref|NP_833500.1| gi|218904905|ref|YP_002452739.1| gi|222097223|ref|YP_002531280.1| gi|217961198|ref|YP_002339766.1| gi|49478932|ref|YP_037838.1| gi|452200159|ref|YP_007480240.1| gi|384187781|ref|YP_005573677.1| gi|218235021|ref|YP_002368580.1| gi|402556100|ref|YP_006597371.1| gi|225865758|ref|YP_002751136.1| NP_833500.1.86172 WP_001221095.1.100059 WP_001221095.1.100082 WP_001221095.1.100241 WP_001221095.1.100409 WP_001221095.1.10055 WP_001221095.1.100684 WP_001221095.1.10069 WP_001221095.1.100912 WP_001221095.1.101224 WP_001221095.1.101309 WP_001221095.1.101550 WP_001221095.1.101931 WP_001221095.1.10584 WP_001221095.1.10688 WP_001221095.1.10745 WP_001221095.1.10762 WP_001221095.1.11044 WP_001221095.1.11060 WP_001221095.1.11387 WP_001221095.1.11584 WP_001221095.1.1228 WP_001221095.1.12289 WP_001221095.1.12751 WP_001221095.1.13024 WP_001221095.1.13221 WP_001221095.1.13299 WP_001221095.1.1354 WP_001221095.1.14006 WP_001221095.1.14039 WP_001221095.1.14174 WP_001221095.1.14176 WP_001221095.1.14882 WP_001221095.1.16013 WP_001221095.1.16156 WP_001221095.1.16199 WP_001221095.1.17374 WP_001221095.1.17408 WP_001221095.1.17424 WP_001221095.1.17899 WP_001221095.1.17927 WP_001221095.1.1850 WP_001221095.1.18840 WP_001221095.1.18914 WP_001221095.1.19173 WP_001221095.1.19438 WP_001221095.1.195 WP_001221095.1.20208 WP_001221095.1.20651 WP_001221095.1.20665 WP_001221095.1.20687 WP_001221095.1.20865 WP_001221095.1.20973 WP_001221095.1.21055 WP_001221095.1.21172 WP_001221095.1.21643 WP_001221095.1.22152 WP_001221095.1.2251 WP_001221095.1.226 WP_001221095.1.22699 WP_001221095.1.23100 WP_001221095.1.23110 WP_001221095.1.23181 WP_001221095.1.23200 WP_001221095.1.23245 WP_001221095.1.23307 WP_001221095.1.23360 WP_001221095.1.23540 WP_001221095.1.23615 WP_001221095.1.23652 WP_001221095.1.23873 WP_001221095.1.24182 WP_001221095.1.24184 WP_001221095.1.24377 WP_001221095.1.24676 WP_001221095.1.24680 WP_001221095.1.24709 WP_001221095.1.24759 WP_001221095.1.24795 WP_001221095.1.25081 WP_001221095.1.2521 WP_001221095.1.25290 WP_001221095.1.25316 WP_001221095.1.25599 WP_001221095.1.2569 WP_001221095.1.25757 WP_001221095.1.26000 WP_001221095.1.26483 WP_001221095.1.26499 WP_001221095.1.26513 WP_001221095.1.26637 WP_001221095.1.26826 WP_001221095.1.26872 WP_001221095.1.27334 WP_001221095.1.28237 WP_001221095.1.28913 WP_001221095.1.29209 WP_001221095.1.29451 WP_001221095.1.29804 WP_001221095.1.30216 WP_001221095.1.3026 WP_001221095.1.30317 WP_001221095.1.30336 WP_001221095.1.31221 WP_001221095.1.31503 WP_001221095.1.31685 WP_001221095.1.3180 WP_001221095.1.3249 WP_001221095.1.32522 WP_001221095.1.32784 WP_001221095.1.32927 WP_001221095.1.33045 WP_001221095.1.33061 WP_001221095.1.3318 WP_001221095.1.33201 WP_001221095.1.33536 WP_001221095.1.33717 WP_001221095.1.33790 WP_001221095.1.33828 WP_001221095.1.34158 WP_001221095.1.35255 WP_001221095.1.35518 WP_001221095.1.3561 WP_001221095.1.35694 WP_001221095.1.3612 WP_001221095.1.3615 WP_001221095.1.36221 WP_001221095.1.3699 WP_001221095.1.37093 WP_001221095.1.37626 WP_001221095.1.3798 WP_001221095.1.37990 WP_001221095.1.38345 WP_001221095.1.38425 WP_001221095.1.38517 WP_001221095.1.39001 WP_001221095.1.39411 WP_001221095.1.39957 WP_001221095.1.40034 WP_001221095.1.40430 WP_001221095.1.40839 WP_001221095.1.41365 WP_001221095.1.41464 WP_001221095.1.41518 WP_001221095.1.41729 WP_001221095.1.41976 WP_001221095.1.42165 WP_001221095.1.42217 WP_001221095.1.42485 WP_001221095.1.43104 WP_001221095.1.43434 WP_001221095.1.43442 WP_001221095.1.43762 WP_001221095.1.43914 WP_001221095.1.44348 WP_001221095.1.44428 WP_001221095.1.44463 WP_001221095.1.44483 WP_001221095.1.44956 WP_001221095.1.45089 WP_001221095.1.45317 WP_001221095.1.45385 WP_001221095.1.45919 WP_001221095.1.46244 WP_001221095.1.46326 WP_001221095.1.46476 WP_001221095.1.4649 WP_001221095.1.46549 WP_001221095.1.46746 WP_001221095.1.46864 WP_001221095.1.47000 WP_001221095.1.47097 WP_001221095.1.47437 WP_001221095.1.47936 WP_001221095.1.47975 WP_001221095.1.48010 WP_001221095.1.48164 WP_001221095.1.48311 WP_001221095.1.48599 WP_001221095.1.4865 WP_001221095.1.49428 WP_001221095.1.4964 WP_001221095.1.49802 WP_001221095.1.49831 WP_001221095.1.5025 WP_001221095.1.50316 WP_001221095.1.50514 WP_001221095.1.50770 WP_001221095.1.51072 WP_001221095.1.51167 WP_001221095.1.51335 WP_001221095.1.51656 WP_001221095.1.51681 WP_001221095.1.52494 WP_001221095.1.52756 WP_001221095.1.53621 WP_001221095.1.53879 WP_001221095.1.54116 WP_001221095.1.54142 WP_001221095.1.54240 WP_001221095.1.54736 WP_001221095.1.54775 WP_001221095.1.54782 WP_001221095.1.55057 WP_001221095.1.55077 WP_001221095.1.55116 WP_001221095.1.55968 WP_001221095.1.56055 WP_001221095.1.56318 WP_001221095.1.56320 WP_001221095.1.56580 WP_001221095.1.57203 WP_001221095.1.57561 WP_001221095.1.57565 WP_001221095.1.57732 WP_001221095.1.57815 WP_001221095.1.57859 WP_001221095.1.58037 WP_001221095.1.58328 WP_001221095.1.58586 WP_001221095.1.58814 WP_001221095.1.58822 WP_001221095.1.5895 WP_001221095.1.59052 WP_001221095.1.59058 WP_001221095.1.59173 WP_001221095.1.59773 WP_001221095.1.59978 WP_001221095.1.59997 WP_001221095.1.60153 WP_001221095.1.60255 WP_001221095.1.60274 WP_001221095.1.60334 WP_001221095.1.60781 WP_001221095.1.60841 WP_001221095.1.61231 WP_001221095.1.61243 WP_001221095.1.61944 WP_001221095.1.62107 WP_001221095.1.62277 WP_001221095.1.62300 WP_001221095.1.62770 WP_001221095.1.6304 WP_001221095.1.63137 WP_001221095.1.6340 WP_001221095.1.63611 WP_001221095.1.63789 WP_001221095.1.63902 WP_001221095.1.64282 WP_001221095.1.64377 WP_001221095.1.64491 WP_001221095.1.64568 WP_001221095.1.64706 WP_001221095.1.6475 WP_001221095.1.65758 WP_001221095.1.65803 WP_001221095.1.65983 WP_001221095.1.66331 WP_001221095.1.66357 WP_001221095.1.66932 WP_001221095.1.66999 WP_001221095.1.67001 WP_001221095.1.67108 WP_001221095.1.67239 WP_001221095.1.6753 WP_001221095.1.67873 WP_001221095.1.67912 WP_001221095.1.6816 WP_001221095.1.6846 WP_001221095.1.68562 WP_001221095.1.69323 WP_001221095.1.69970 WP_001221095.1.70645 WP_001221095.1.7096 WP_001221095.1.71114 WP_001221095.1.71242 WP_001221095.1.71441 WP_001221095.1.71648 WP_001221095.1.71652 WP_001221095.1.71953 WP_001221095.1.72484 WP_001221095.1.72514 WP_001221095.1.73396 WP_001221095.1.73457 WP_001221095.1.73594 WP_001221095.1.73790 WP_001221095.1.7398 WP_001221095.1.74302 WP_001221095.1.74337 WP_001221095.1.74863 WP_001221095.1.7544 WP_001221095.1.7545 WP_001221095.1.75866 WP_001221095.1.75915 WP_001221095.1.7593 WP_001221095.1.76086 WP_001221095.1.76155 WP_001221095.1.7628 WP_001221095.1.76804 WP_001221095.1.76902 WP_001221095.1.77370 WP_001221095.1.77567 WP_001221095.1.77576 WP_001221095.1.77690 WP_001221095.1.77902 WP_001221095.1.782 WP_001221095.1.7856 WP_001221095.1.79043 WP_001221095.1.79252 WP_001221095.1.79549 WP_001221095.1.79658 WP_001221095.1.79687 WP_001221095.1.80126 WP_001221095.1.80239 WP_001221095.1.80571 WP_001221095.1.80622 WP_001221095.1.80649 WP_001221095.1.80964 WP_001221095.1.81088 WP_001221095.1.81570 WP_001221095.1.81773 WP_001221095.1.82421 WP_001221095.1.82533 WP_001221095.1.82986 WP_001221095.1.83070 WP_001221095.1.84337 WP_001221095.1.84422 WP_001221095.1.8450 WP_001221095.1.84541 WP_001221095.1.84775 WP_001221095.1.85348 WP_001221095.1.85592 WP_001221095.1.85667 WP_001221095.1.8577 WP_001221095.1.85901 WP_001221095.1.86082 WP_001221095.1.86374 WP_001221095.1.86619 WP_001221095.1.86637 WP_001221095.1.869 WP_001221095.1.87627 WP_001221095.1.87768 WP_001221095.1.87777 WP_001221095.1.87873 WP_001221095.1.87947 WP_001221095.1.88154 WP_001221095.1.88200 WP_001221095.1.88269 WP_001221095.1.88431 WP_001221095.1.8923 WP_001221095.1.89675 WP_001221095.1.89718 WP_001221095.1.90155 WP_001221095.1.90254 WP_001221095.1.90352 WP_001221095.1.90466 WP_001221095.1.90596 WP_001221095.1.90671 WP_001221095.1.91020 WP_001221095.1.91404 WP_001221095.1.91569 WP_001221095.1.91615 WP_001221095.1.92347 WP_001221095.1.9269 WP_001221095.1.93683 WP_001221095.1.93893 WP_001221095.1.93932 WP_001221095.1.94308 WP_001221095.1.94373 WP_001221095.1.94914 WP_001221095.1.95308 WP_001221095.1.95457 WP_001221095.1.95484 WP_001221095.1.95576 WP_001221095.1.95786 WP_001221095.1.9623 WP_001221095.1.96287 WP_001221095.1.96356 WP_001221095.1.96437 WP_001221095.1.9700 WP_001221095.1.97082 WP_001221095.1.97149 WP_001221095.1.97262 WP_001221095.1.97561 WP_001221095.1.97617 WP_001221095.1.97670 WP_001221095.1.97816 WP_001221095.1.97842 WP_001221095.1.97993 WP_001221095.1.98053 WP_001221095.1.98519 WP_001221095.1.98557 WP_001221095.1.98571 WP_001221095.1.98604 WP_001221095.1.99212 WP_001221095.1.99266 WP_001221095.1.99454 WP_001221095.1.99636 YP_037838.1.62562 222523.BCE_3812 226900.BC3777 281309.BT9727_3518 288681.BCZK3536 361100.BCQ_3563 405532.BCB4264_A3876 405534.BCAH187_A3824 405535.BCAH820_3789 412694.BALH_3405 572264.BCA_3874 gi|42782862|ref|NP_980109.1| gi|410676098|ref|YP_006928469.1| gi|558682334|ref|YP_008820463.1| gi|375285699|ref|YP_005106138.1| gi|384181587|ref|YP_005567349.1| gi|376267670|ref|YP_005120382.1| gi|296504276|ref|YP_003665976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]