SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218235319|ref|YP_002366268.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218235319|ref|YP_002366268.1|
Domain Number 1 Region: 45-257
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.6e-28
Family YfcE-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218235319|ref|YP_002366268.1|
Sequence length 258
Comment hypothetical protein BCB4264_A1543 [Bacillus cereus B4264]
Sequence
MIWIILFSTLIGMGILLLFVMYKEAMRNTVLEHTLVFKEFPKSFQKVNVFFISDIHRRVI
SNLLIEQVKGKVDLVIIGGDLAEKGVSLSKISANIQKLREIGPVYFVWGNNDYEIEYHEL
DALLLENNVKVLDNTRVVFESELGEKICLLGIDDVGLHRDRLDLALADCKEDGFRILVSH
NPDIIKKMSGNEQISLVLSGHTHGGQIRLFPSKKYLKGGVYNHLNTILFVSNGYGTTLIP
LRFRAPAQTHIITLCGGK
Download sequence
Identical sequences A0A0J6Z6P0 A0A0T8DV34 A0A1M6HI53 A0A1Q9KKW4 A0A1Y0TDT8 A0A229M5J4 A0A243DND7 A0A243HJ25 B7HHP1 J8MXF5 J8NLF9 N1LPK8 Q81FT1 R8H9T5
BcR214 NP_831267.1.86172 WP_000637791.1.10055 WP_000637791.1.100912 WP_000637791.1.1354 WP_000637791.1.14006 WP_000637791.1.14039 WP_000637791.1.14176 WP_000637791.1.19438 WP_000637791.1.20208 WP_000637791.1.20651 WP_000637791.1.25599 WP_000637791.1.26513 WP_000637791.1.26637 WP_000637791.1.26826 WP_000637791.1.28237 WP_000637791.1.32784 WP_000637791.1.32927 WP_000637791.1.33201 WP_000637791.1.33717 WP_000637791.1.38345 WP_000637791.1.39957 WP_000637791.1.41464 WP_000637791.1.41518 WP_000637791.1.45317 WP_000637791.1.4964 WP_000637791.1.5025 WP_000637791.1.51072 WP_000637791.1.55116 WP_000637791.1.56320 WP_000637791.1.59058 WP_000637791.1.59997 WP_000637791.1.60153 WP_000637791.1.60334 WP_000637791.1.6304 WP_000637791.1.64282 WP_000637791.1.65803 WP_000637791.1.67001 WP_000637791.1.67873 WP_000637791.1.67912 WP_000637791.1.6846 WP_000637791.1.68562 WP_000637791.1.71114 WP_000637791.1.73396 WP_000637791.1.73457 WP_000637791.1.7593 WP_000637791.1.76086 WP_000637791.1.76155 WP_000637791.1.76804 WP_000637791.1.76902 WP_000637791.1.80126 WP_000637791.1.80649 WP_000637791.1.81773 WP_000637791.1.85592 WP_000637791.1.87768 WP_000637791.1.88200 WP_000637791.1.95576 WP_000637791.1.96287 WP_000637791.1.96437 WP_000637791.1.97670 WP_000637791.1.97842 WP_000637791.1.98604 gi|30019636|ref|NP_831267.1| gi|218235319|ref|YP_002366268.1| 226900.BC1488 405532.BCB4264_A1543 gi|296502157|ref|YP_003663857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]