SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218235887|ref|YP_002367563.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218235887|ref|YP_002367563.1|
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.8e-52
Family Phosphoesterase-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218235887|ref|YP_002367563.1|
Sequence length 278
Comment Ser/Thr protein phosphatase [Bacillus cereus B4264]
Sequence
MKHKIAVLADVHGNATALKAVIEDSMKEGVTDYWFLGDLIMPGPGSNDLFEILESINVDT
YVQGNWEDSFLDVLNKNIDIDNATDIYVSRLVQYQCENLDENYIKHVKNLPLHITKQVND
LSISISHNLQNKNYGGDLWPTNNQEQFDRLFDRDYDIAIYAHTHHQLLRYSSNDQLIINP
GTVGQPFYKWNKLNSDLRAQYAILEIDEAGITDVRFKKVFYDVEKEYKNAINKNLPYIDL
YRELLETGKTHTHDIELLQEINDKYNYKDEVIKFIEKI
Download sequence
Identical sequences A0A0D1RDR6 A0A2A7F709 A0A2J9DPF1 B7HA64 C2R9B1 C3E4J5 J8L4S2 N1LJ29
405532.BCB4264_A2855 WP_000680866.1.14039 WP_000680866.1.18914 WP_000680866.1.23540 WP_000680866.1.23652 WP_000680866.1.36221 WP_000680866.1.39957 WP_000680866.1.63902 WP_000680866.1.73457 WP_000680866.1.7593 WP_000680866.1.76086 WP_000680866.1.76804 WP_000680866.1.81773 WP_000680866.1.85348 WP_000680866.1.86619 WP_000680866.1.90352 WP_000680866.1.95576 WP_000680866.1.97670 gi|218235887|ref|YP_002367563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]