SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218231983|ref|YP_002369984.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218231983|ref|YP_002369984.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 7.98e-38
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218231983|ref|YP_002369984.1|
Sequence length 107
Comment PTS system cellobiose-specific transporter subunit IIA [Bacillus cereus B4264]
Sequence
MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELI
QSEARGEKTEVSVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKGE
Download sequence
Identical sequences A0A063CIG3 A0A0D1R5G8 A0A0P0PJB1 A0A125U4U0 A0A1H6ARA0 A0A1J9UR04 A0A1Q9KSV6 A0A243D369 A0A243HNF7 A0A2A8LC87 A0A2B4F6A1 A0A2B5KBG1 B7HEL0 C2NQF7 C2R0U5 C3EB31 J8L183 N1LH25 R8T7Y4
gi|225867171|ref|YP_002752549.1| gi|218231983|ref|YP_002369984.1| WP_000989055.1.100082 WP_000989055.1.101720 WP_000989055.1.10584 WP_000989055.1.1228 WP_000989055.1.12553 WP_000989055.1.13221 WP_000989055.1.14006 WP_000989055.1.14039 WP_000989055.1.17374 WP_000989055.1.18914 WP_000989055.1.20973 WP_000989055.1.226 WP_000989055.1.23427 WP_000989055.1.23540 WP_000989055.1.23652 WP_000989055.1.23873 WP_000989055.1.24676 WP_000989055.1.2521 WP_000989055.1.2569 WP_000989055.1.28237 WP_000989055.1.28913 WP_000989055.1.3026 WP_000989055.1.30317 WP_000989055.1.30788 WP_000989055.1.31503 WP_000989055.1.3612 WP_000989055.1.36221 WP_000989055.1.37027 WP_000989055.1.37384 WP_000989055.1.3798 WP_000989055.1.39957 WP_000989055.1.40034 WP_000989055.1.42237 WP_000989055.1.4447 WP_000989055.1.44483 WP_000989055.1.45317 WP_000989055.1.46244 WP_000989055.1.46326 WP_000989055.1.47095 WP_000989055.1.4964 WP_000989055.1.5025 WP_000989055.1.51335 WP_000989055.1.52494 WP_000989055.1.53621 WP_000989055.1.54736 WP_000989055.1.56320 WP_000989055.1.59058 WP_000989055.1.61820 WP_000989055.1.62107 WP_000989055.1.6340 WP_000989055.1.63902 WP_000989055.1.64568 WP_000989055.1.65803 WP_000989055.1.67108 WP_000989055.1.69323 WP_000989055.1.71142 WP_000989055.1.71441 WP_000989055.1.73457 WP_000989055.1.7398 WP_000989055.1.74337 WP_000989055.1.7593 WP_000989055.1.76086 WP_000989055.1.7628 WP_000989055.1.76342 WP_000989055.1.782 WP_000989055.1.81773 WP_000989055.1.83206 WP_000989055.1.84422 WP_000989055.1.86619 WP_000989055.1.8759 WP_000989055.1.87768 WP_000989055.1.87960 WP_000989055.1.88431 WP_000989055.1.90254 WP_000989055.1.90352 WP_000989055.1.92586 WP_000989055.1.96287 WP_000989055.1.97262 WP_000989055.1.97670 WP_000989055.1.98557 WP_000989055.1.98571 405532.BCB4264_A5329 572264.BCA_5338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]