SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218236054|ref|YP_002369989.1| from Bacillus cereus B4264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218236054|ref|YP_002369989.1|
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218236054|ref|YP_002369989.1|
Sequence length 83
Comment PTS system cellobiose-specific transporter subunit IIA [Bacillus cereus B4264]
Sequence
MEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTELIQKEAGGEKTEVTLLMVHAQDHLM
NAITVKELASEFVELYRKMSVDE
Download sequence
Identical sequences A0A162TA00 B7HEL5 C2N954 C2RFX3 C2T8M0 C2ULK1 C2XJB3 M1QNR6 N1LH19
gi|452201703|ref|YP_007481784.1| 405532.BCB4264_A5334 gi|218236054|ref|YP_002369989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]