SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187926345|ref|YP_001892690.1| from Ralstonia pickettii 12J

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187926345|ref|YP_001892690.1|
Domain Number 1 Region: 632-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 3-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.21e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0034
Further Details:      
 
Domain Number 3 Region: 501-640
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187926345|ref|YP_001892690.1|
Sequence length 851
Comment nitrite reductase (NAD(P)H) large subunit [Ralstonia pickettii 12J]
Sequence
MTMKIVVIGHGMVGHKFLESLLHAPGHHLQVTVLCEEPRPAYDRVHLSEFFTGKTAEELS
LVAPGFFDRDDVVLKLNARATAIDITAKTVTASTGEVLPYDKLVLASGSSPFVPPVPGRD
RKDCFVYRTIEDLEAMAECGQRAKTGVVIGGGLLGLECAKALRDMNLQTHVVEFAGRLMA
MQVDDGGGRMLRRKIEDLGVTVHTQKNTSEIVDGETATHRLNFADGTHLEADMVVFSAGI
RPRDELARACGLEVGERGGIVIDSECRTSAPDVYAIGECALWGGKIYGLVAPGYEMARIT
AKQILAADDASEFSGADMSTKLKLMGVDVASLGDAQGVTPGSRSVQFTDERKQIYKKLVV
SEDGKYLLGGVLVGDAAEYGTLLQMMLNRIELPEAPEFLILPQADGNARPALGVDALPDS
AQICSCNDVSKGALCQAVCAGATTVGALKDATKAGTSCGGCVPLMTQVMKAEMKKQGLAV
NNHICEHFPYSRQELYHLVRVGRIQSFEALLEAHGSGMGCDICKPAVASILASCWNDFVL
KKEHASLQDSNDYFLANIQKDGTYSVVPRMPGGEVTADGLIAVGQVAKKYDLYTKITGGQ
RVDLFGARLEQLPLIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRYGVGDSVGFAIAL
ENRYKGLRSPHKIKFGVSGCTRECAEAQGKDVGIIATEKGWNLYVCGNGGMKPRHAELLA
ADLDQETLIKYVDRFLMFYVRTADRLQRTSTWRDNLEGGLDYLKDVVINDKLGIVAELEA
EMQHVVDTYQDEWKTAVTNPDVRKRFRHFVNSEAKDANVVFVEERGQIRPATVEERAKTR
PVRIPVVAEAA
Download sequence
Identical sequences B2UI62 C6BN61
gi|187926345|ref|YP_001892690.1| 402626.Rpic_4164 428406.Rpic12D_4276 gi|241665832|ref|YP_002984191.1| WP_012430234.1.43321 WP_012430234.1.7259 WP_012430234.1.7297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]