SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206559702|ref|YP_002230466.1| from Burkholderia cenocepacia J2315

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206559702|ref|YP_002230466.1|
Domain Number 1 Region: 2-357
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.92e-105
Family FMN-linked oxidoreductases 0.00000000194
Further Details:      
 
Domain Number 2 Region: 328-514
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.89e-39
Family N-terminal domain of adrenodoxin reductase-like 0.00000777
Further Details:      
 
Domain Number 3 Region: 457-515,551-645
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206559702|ref|YP_002230466.1|
Sequence length 667
Comment putative 2,4-dienoyl-CoA reductase [Burkholderia cenocepacia J2315]
Sequence
MTTPLELGFTSLRNRVLMGSMHVGLEEAPNGFERMAAFYAERARGEAGLIVTGGFAPNER
GRPAPGGAMLTTEADAERHRVVTRAVQAEGGRIALQILHFGRYAYHPALAAPSALKAPIN
PFTPHALTSDEVDETIADFVRCAALAQHAGYDGVEIMGSEGYLINEFIAARTNHRDDAWG
GAYDNRIRFAVEIVRRVRERVGANFIVIYRLSMLDLVEGGSTLDEVIRLARAIEAAGATI
LNTGIGWHEARIPTIATKVPRAAYAWVTRQLMGKVGIPLVATNRINTPEVAEQLLADGYC
DMVSMARPFLADAEFVRKAREGRADEINTCIGCNQACLDHTFSGRITSCLVNPRACHETE
LVIAPAPRRKRIAVVGAGPAGLGFAVTAAERGHAVTLYEAGAEIGGQFNLARKVPGKEEF
NETLRYFRRQIELRGIALHVDTRATAEMLLQGEFDEVVIATGIVPRTPPIDGVGHPKALG
YLDVLRDDKAVGNSVAIVGAGGIGFDVAEYLVHRDRGEHGDADRFFSEWGVDRSYANAGG
LGAARPEPAAREVHLLQRKASKVGDGLGKTTGWIHRTALKARGVGMSSSVTYRRIDDDGF
HVTIDGVERTLPVDNVVICAGQEPSRELAEQLQAAGCRVHLIGGAYEAAELDAKRAIHQG
TTLAATL
Download sequence
Identical sequences B4E657
216591.BCAL1336 gi|206559702|ref|YP_002230466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]