SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218695072|ref|YP_002402739.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218695072|ref|YP_002402739.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.88e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218695072|ref|YP_002402739.1|
Sequence length 104
Comment PTS system lactose/cellobiose-specific transporter subunit IIA [Escherichia coli 55989]
Sequence
MMFADEELVMELLVNAGQARSDAMEAIRCAGQKDWQGATQLMASSESACLQAHKIQTALI
SQDEGCGKIKVNLILIHAQDHLMNAILCQDLAREIISLRKELHA
Download sequence
Identical sequences A0A0U4K1I5 B6IAT8 B7L8L4 C8U8K5
gi|209918816|ref|YP_002292900.1| gi|218554068|ref|YP_002386981.1| gi|218695072|ref|YP_002402739.1| gi|260843839|ref|YP_003221617.1| 409438.ECSE_1625 585034.ECIAI1_1548 585055.EC55989_1670 585395.ECO103_1666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]