SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218695294|ref|YP_002402961.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218695294|ref|YP_002402961.1|
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.36e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218695294|ref|YP_002402961.1|
Sequence length 116
Comment PTS system N,N'-diacetylchitobiose-specific transporter subunit IIA [Escherichia coli 55989]
Sequence
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMIDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA
Download sequence
Identical sequences A0A0E0Y1U9 A0A222QKR2 A0A2H3LQD3 B7L6L0
585055.EC55989_1904 gi|407469532|ref|YP_006784025.1| gi|218695294|ref|YP_002402961.1| gi|407481803|ref|YP_006778952.1| WP_000968911.1.100499 WP_000968911.1.10080 WP_000968911.1.101359 WP_000968911.1.101845 WP_000968911.1.12344 WP_000968911.1.17172 WP_000968911.1.19147 WP_000968911.1.19581 WP_000968911.1.20159 WP_000968911.1.23393 WP_000968911.1.24575 WP_000968911.1.26270 WP_000968911.1.2642 WP_000968911.1.26613 WP_000968911.1.27060 WP_000968911.1.27856 WP_000968911.1.28683 WP_000968911.1.33341 WP_000968911.1.35465 WP_000968911.1.36042 WP_000968911.1.36812 WP_000968911.1.36975 WP_000968911.1.39690 WP_000968911.1.41752 WP_000968911.1.43137 WP_000968911.1.43177 WP_000968911.1.44029 WP_000968911.1.4449 WP_000968911.1.46616 WP_000968911.1.47050 WP_000968911.1.4857 WP_000968911.1.49124 WP_000968911.1.49774 WP_000968911.1.49954 WP_000968911.1.50418 WP_000968911.1.52691 WP_000968911.1.532 WP_000968911.1.5342 WP_000968911.1.54023 WP_000968911.1.55417 WP_000968911.1.5561 WP_000968911.1.55787 WP_000968911.1.56149 WP_000968911.1.56689 WP_000968911.1.58507 WP_000968911.1.60325 WP_000968911.1.62762 WP_000968911.1.63556 WP_000968911.1.654 WP_000968911.1.67383 WP_000968911.1.73908 WP_000968911.1.74735 WP_000968911.1.75021 WP_000968911.1.76656 WP_000968911.1.77162 WP_000968911.1.77462 WP_000968911.1.78445 WP_000968911.1.79067 WP_000968911.1.81026 WP_000968911.1.81580 WP_000968911.1.86210 WP_000968911.1.91290 WP_000968911.1.94808 WP_000968911.1.96341 WP_000968911.1.9661 WP_000968911.1.96944 WP_000968911.1.99046 WP_000968911.1.99304 WP_000968911.1.99592 YP_006778952.1.12065 gi|410482354|ref|YP_006769900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]