SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218696063|ref|YP_002403730.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218696063|ref|YP_002403730.1|
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily SIS domain 3.56e-66
Family mono-SIS domain 0.000000273
Further Details:      
 
Weak hits

Sequence:  gi|218696063|ref|YP_002403730.1|
Domain Number - Region: 235-280
Classification Level Classification E-value
Superfamily UBA-like 0.0643
Family UBA domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218696063|ref|YP_002403730.1|
Sequence length 298
Comment N-acetylmuramic acid 6-phosphate etherase [Escherichia coli 55989]
Sequence
MQLEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
VNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE
Download sequence
Identical sequences A0A026UKN9 A0A028ATP1 A0A028EE64 A0A070FEH0 A0A074HWR9 A0A080FTJ1 A0A0A8UF87 A0A0E0U2H7 A0A0E0XWC5 A0A1H0CFH3 A0A1S6TDS2 A0A1X3J363 A0A1X3L039 A0A222QN95 A0A2A2XLJ7 A7ZPM8 B6I504 B7LCH2 B7M6T7 D6HZJ8 D7XJV8 D8E2P9 E0J1J1 E1INL4 E1JD34 E6BH92 E9TBL1 F4NH81 F4VEN6 I0VT70 I2SWX1 I2WI19 J7R702 J7RTN0 K4XSE0 U9XKW5 V6FWM1
331111.EcE24377A_2714 409438.ECSE_2718 573235.ECO26_3480 585034.ECIAI1_2485 585055.EC55989_2717 gi|218696063|ref|YP_002403730.1| gi|544391001|ref|YP_008565579.1| gi|410481579|ref|YP_006769125.1| gi|386710324|ref|YP_006174045.1| gi|209919909|ref|YP_002293993.1| gi|260856529|ref|YP_003230420.1| gi|386615086|ref|YP_006134752.1| WP_001175648.1.100044 WP_001175648.1.100066 WP_001175648.1.100185 WP_001175648.1.100346 WP_001175648.1.100425 WP_001175648.1.100444 WP_001175648.1.100451 WP_001175648.1.100499 WP_001175648.1.100543 WP_001175648.1.100573 WP_001175648.1.100614 WP_001175648.1.100667 WP_001175648.1.10067 WP_001175648.1.10068 WP_001175648.1.100689 WP_001175648.1.100752 WP_001175648.1.100753 WP_001175648.1.100758 WP_001175648.1.100796 WP_001175648.1.10080 WP_001175648.1.100836 WP_001175648.1.10086 WP_001175648.1.100867 WP_001175648.1.100928 WP_001175648.1.100933 WP_001175648.1.100990 WP_001175648.1.101096 WP_001175648.1.101102 WP_001175648.1.101157 WP_001175648.1.101216 WP_001175648.1.10126 WP_001175648.1.101289 WP_001175648.1.101359 WP_001175648.1.101436 WP_001175648.1.101468 WP_001175648.1.10154 WP_001175648.1.101651 WP_001175648.1.101653 WP_001175648.1.101668 WP_001175648.1.101686 WP_001175648.1.10173 WP_001175648.1.101777 WP_001175648.1.101822 WP_001175648.1.10184 WP_001175648.1.101840 WP_001175648.1.101845 WP_001175648.1.10187 WP_001175648.1.10190 WP_001175648.1.101900 WP_001175648.1.101913 WP_001175648.1.101947 WP_001175648.1.102069 WP_001175648.1.10400 WP_001175648.1.10461 WP_001175648.1.10538 WP_001175648.1.10579 WP_001175648.1.10607 WP_001175648.1.10651 WP_001175648.1.10673 WP_001175648.1.1071 WP_001175648.1.10763 WP_001175648.1.10798 WP_001175648.1.10922 WP_001175648.1.10940 WP_001175648.1.10988 WP_001175648.1.11006 WP_001175648.1.11032 WP_001175648.1.11071 WP_001175648.1.11091 WP_001175648.1.11118 WP_001175648.1.11121 WP_001175648.1.1122 WP_001175648.1.11436 WP_001175648.1.11524 WP_001175648.1.11578 WP_001175648.1.11699 WP_001175648.1.11759 WP_001175648.1.11801 WP_001175648.1.1186 WP_001175648.1.11949 WP_001175648.1.11985 WP_001175648.1.12030 WP_001175648.1.12051 WP_001175648.1.12320 WP_001175648.1.12342 WP_001175648.1.12344 WP_001175648.1.1242 WP_001175648.1.12458 WP_001175648.1.12478 WP_001175648.1.12566 WP_001175648.1.12645 WP_001175648.1.12693 WP_001175648.1.12717 WP_001175648.1.12749 WP_001175648.1.1275 WP_001175648.1.12781 WP_001175648.1.12876 WP_001175648.1.12911 WP_001175648.1.12987 WP_001175648.1.13015 WP_001175648.1.13074 WP_001175648.1.1315 WP_001175648.1.13252 WP_001175648.1.13278 WP_001175648.1.13301 WP_001175648.1.1335 WP_001175648.1.13495 WP_001175648.1.13525 WP_001175648.1.13601 WP_001175648.1.13624 WP_001175648.1.13656 WP_001175648.1.13791 WP_001175648.1.13924 WP_001175648.1.13944 WP_001175648.1.14058 WP_001175648.1.14062 WP_001175648.1.14070 WP_001175648.1.14199 WP_001175648.1.14277 WP_001175648.1.14304 WP_001175648.1.1439 WP_001175648.1.14398 WP_001175648.1.14432 WP_001175648.1.14493 WP_001175648.1.14508 WP_001175648.1.14536 WP_001175648.1.14582 WP_001175648.1.14601 WP_001175648.1.14678 WP_001175648.1.14693 WP_001175648.1.14879 WP_001175648.1.14956 WP_001175648.1.14977 WP_001175648.1.1510 WP_001175648.1.15138 WP_001175648.1.15193 WP_001175648.1.15221 WP_001175648.1.1524 WP_001175648.1.15270 WP_001175648.1.15277 WP_001175648.1.15282 WP_001175648.1.15335 WP_001175648.1.15377 WP_001175648.1.15416 WP_001175648.1.1543 WP_001175648.1.15444 WP_001175648.1.15469 WP_001175648.1.15521 WP_001175648.1.15528 WP_001175648.1.1561 WP_001175648.1.15620 WP_001175648.1.15626 WP_001175648.1.15752 WP_001175648.1.15791 WP_001175648.1.15809 WP_001175648.1.15916 WP_001175648.1.15945 WP_001175648.1.16014 WP_001175648.1.16087 WP_001175648.1.16154 WP_001175648.1.16171 WP_001175648.1.16194 WP_001175648.1.163 WP_001175648.1.16387 WP_001175648.1.16388 WP_001175648.1.1640 WP_001175648.1.16517 WP_001175648.1.16539 WP_001175648.1.16592 WP_001175648.1.16682 WP_001175648.1.16745 WP_001175648.1.16805 WP_001175648.1.16861 WP_001175648.1.16992 WP_001175648.1.1710 WP_001175648.1.17102 WP_001175648.1.17111 WP_001175648.1.17123 WP_001175648.1.17170 WP_001175648.1.17172 WP_001175648.1.17242 WP_001175648.1.17297 WP_001175648.1.17356 WP_001175648.1.17373 WP_001175648.1.17403 WP_001175648.1.17464 WP_001175648.1.17595 WP_001175648.1.17637 WP_001175648.1.1766 WP_001175648.1.1769 WP_001175648.1.17802 WP_001175648.1.17829 WP_001175648.1.17920 WP_001175648.1.17961 WP_001175648.1.17963 WP_001175648.1.17984 WP_001175648.1.18000 WP_001175648.1.18006 WP_001175648.1.18050 WP_001175648.1.18094 WP_001175648.1.18175 WP_001175648.1.18226 WP_001175648.1.18338 WP_001175648.1.18438 WP_001175648.1.1844 WP_001175648.1.18458 WP_001175648.1.18530 WP_001175648.1.18649 WP_001175648.1.18650 WP_001175648.1.1866 WP_001175648.1.1867 WP_001175648.1.18714 WP_001175648.1.18861 WP_001175648.1.18874 WP_001175648.1.18899 WP_001175648.1.18983 WP_001175648.1.1906 WP_001175648.1.1909 WP_001175648.1.19090 WP_001175648.1.19114 WP_001175648.1.19147 WP_001175648.1.1925 WP_001175648.1.19312 WP_001175648.1.19314 WP_001175648.1.19347 WP_001175648.1.19389 WP_001175648.1.19424 WP_001175648.1.19448 WP_001175648.1.19478 WP_001175648.1.19544 WP_001175648.1.19557 WP_001175648.1.19581 WP_001175648.1.19583 WP_001175648.1.19644 WP_001175648.1.19684 WP_001175648.1.19778 WP_001175648.1.20114 WP_001175648.1.20129 WP_001175648.1.20157 WP_001175648.1.20159 WP_001175648.1.20166 WP_001175648.1.20251 WP_001175648.1.20325 WP_001175648.1.20334 WP_001175648.1.20483 WP_001175648.1.20519 WP_001175648.1.20549 WP_001175648.1.20596 WP_001175648.1.2063 WP_001175648.1.20730 WP_001175648.1.20785 WP_001175648.1.20824 WP_001175648.1.20848 WP_001175648.1.2094 WP_001175648.1.21041 WP_001175648.1.21104 WP_001175648.1.21137 WP_001175648.1.21320 WP_001175648.1.21336 WP_001175648.1.21441 WP_001175648.1.21596 WP_001175648.1.21628 WP_001175648.1.2164 WP_001175648.1.21667 WP_001175648.1.21732 WP_001175648.1.21915 WP_001175648.1.22138 WP_001175648.1.22195 WP_001175648.1.22204 WP_001175648.1.22269 WP_001175648.1.22291 WP_001175648.1.22325 WP_001175648.1.22350 WP_001175648.1.22494 WP_001175648.1.22544 WP_001175648.1.22572 WP_001175648.1.22599 WP_001175648.1.22631 WP_001175648.1.22756 WP_001175648.1.22777 WP_001175648.1.22868 WP_001175648.1.22875 WP_001175648.1.22908 WP_001175648.1.2300 WP_001175648.1.23005 WP_001175648.1.23026 WP_001175648.1.23035 WP_001175648.1.23092 WP_001175648.1.23105 WP_001175648.1.23135 WP_001175648.1.23285 WP_001175648.1.23290 WP_001175648.1.23376 WP_001175648.1.23383 WP_001175648.1.23388 WP_001175648.1.23393 WP_001175648.1.23463 WP_001175648.1.23487 WP_001175648.1.23520 WP_001175648.1.23527 WP_001175648.1.23593 WP_001175648.1.23640 WP_001175648.1.23693 WP_001175648.1.23741 WP_001175648.1.23754 WP_001175648.1.23765 WP_001175648.1.23915 WP_001175648.1.23950 WP_001175648.1.24068 WP_001175648.1.24089 WP_001175648.1.24124 WP_001175648.1.24136 WP_001175648.1.24374 WP_001175648.1.24381 WP_001175648.1.24383 WP_001175648.1.24460 WP_001175648.1.24473 WP_001175648.1.24483 WP_001175648.1.24485 WP_001175648.1.24536 WP_001175648.1.24575 WP_001175648.1.24641 WP_001175648.1.24646 WP_001175648.1.24693 WP_001175648.1.24876 WP_001175648.1.24929 WP_001175648.1.24939 WP_001175648.1.24946 WP_001175648.1.24984 WP_001175648.1.25019 WP_001175648.1.25039 WP_001175648.1.2504 WP_001175648.1.25086 WP_001175648.1.25087 WP_001175648.1.2543 WP_001175648.1.2558 WP_001175648.1.25592 WP_001175648.1.25613 WP_001175648.1.25631 WP_001175648.1.25726 WP_001175648.1.25755 WP_001175648.1.25832 WP_001175648.1.2588 WP_001175648.1.25886 WP_001175648.1.25945 WP_001175648.1.25996 WP_001175648.1.26055 WP_001175648.1.26100 WP_001175648.1.26130 WP_001175648.1.26150 WP_001175648.1.26161 WP_001175648.1.26186 WP_001175648.1.26264 WP_001175648.1.26270 WP_001175648.1.26325 WP_001175648.1.26331 WP_001175648.1.26401 WP_001175648.1.2642 WP_001175648.1.26479 WP_001175648.1.26569 WP_001175648.1.26588 WP_001175648.1.26598 WP_001175648.1.26613 WP_001175648.1.26644 WP_001175648.1.26658 WP_001175648.1.26683 WP_001175648.1.26716 WP_001175648.1.26720 WP_001175648.1.26912 WP_001175648.1.27019 WP_001175648.1.27060 WP_001175648.1.27101 WP_001175648.1.27141 WP_001175648.1.27148 WP_001175648.1.27175 WP_001175648.1.27280 WP_001175648.1.27283 WP_001175648.1.27292 WP_001175648.1.27310 WP_001175648.1.27330 WP_001175648.1.27367 WP_001175648.1.27373 WP_001175648.1.27451 WP_001175648.1.27504 WP_001175648.1.27580 WP_001175648.1.27698 WP_001175648.1.27741 WP_001175648.1.27749 WP_001175648.1.27758 WP_001175648.1.27856 WP_001175648.1.27876 WP_001175648.1.27897 WP_001175648.1.28109 WP_001175648.1.28110 WP_001175648.1.2826 WP_001175648.1.28305 WP_001175648.1.28401 WP_001175648.1.28480 WP_001175648.1.28496 WP_001175648.1.28509 WP_001175648.1.28523 WP_001175648.1.28540 WP_001175648.1.28683 WP_001175648.1.28760 WP_001175648.1.2881 WP_001175648.1.28950 WP_001175648.1.28953 WP_001175648.1.29001 WP_001175648.1.29013 WP_001175648.1.29016 WP_001175648.1.29118 WP_001175648.1.29125 WP_001175648.1.29150 WP_001175648.1.29176 WP_001175648.1.29194 WP_001175648.1.29202 WP_001175648.1.29206 WP_001175648.1.2942 WP_001175648.1.29495 WP_001175648.1.29503 WP_001175648.1.29504 WP_001175648.1.2952 WP_001175648.1.29683 WP_001175648.1.29715 WP_001175648.1.29724 WP_001175648.1.29746 WP_001175648.1.29752 WP_001175648.1.29798 WP_001175648.1.29812 WP_001175648.1.29874 WP_001175648.1.29876 WP_001175648.1.2995 WP_001175648.1.29967 WP_001175648.1.29992 WP_001175648.1.30004 WP_001175648.1.30035 WP_001175648.1.30098 WP_001175648.1.30253 WP_001175648.1.30399 WP_001175648.1.30428 WP_001175648.1.30452 WP_001175648.1.30554 WP_001175648.1.30733 WP_001175648.1.30742 WP_001175648.1.30843 WP_001175648.1.30853 WP_001175648.1.31000 WP_001175648.1.31009 WP_001175648.1.31347 WP_001175648.1.31357 WP_001175648.1.31407 WP_001175648.1.31419 WP_001175648.1.31429 WP_001175648.1.31431 WP_001175648.1.31518 WP_001175648.1.31521 WP_001175648.1.31709 WP_001175648.1.31740 WP_001175648.1.31803 WP_001175648.1.3181 WP_001175648.1.31860 WP_001175648.1.31898 WP_001175648.1.31924 WP_001175648.1.3193 WP_001175648.1.32037 WP_001175648.1.32089 WP_001175648.1.32091 WP_001175648.1.32138 WP_001175648.1.3215 WP_001175648.1.32232 WP_001175648.1.32236 WP_001175648.1.32394 WP_001175648.1.32443 WP_001175648.1.3247 WP_001175648.1.32475 WP_001175648.1.3248 WP_001175648.1.32494 WP_001175648.1.32591 WP_001175648.1.32661 WP_001175648.1.32680 WP_001175648.1.32709 WP_001175648.1.32811 WP_001175648.1.32815 WP_001175648.1.32831 WP_001175648.1.32835 WP_001175648.1.32875 WP_001175648.1.32910 WP_001175648.1.32992 WP_001175648.1.32995 WP_001175648.1.33014 WP_001175648.1.33022 WP_001175648.1.33119 WP_001175648.1.33341 WP_001175648.1.334 WP_001175648.1.33422 WP_001175648.1.3354 WP_001175648.1.33595 WP_001175648.1.33638 WP_001175648.1.33667 WP_001175648.1.33745 WP_001175648.1.33823 WP_001175648.1.33853 WP_001175648.1.33854 WP_001175648.1.33914 WP_001175648.1.3398 WP_001175648.1.34032 WP_001175648.1.34094 WP_001175648.1.34122 WP_001175648.1.3444 WP_001175648.1.34464 WP_001175648.1.34605 WP_001175648.1.34682 WP_001175648.1.347 WP_001175648.1.34781 WP_001175648.1.34782 WP_001175648.1.34794 WP_001175648.1.34855 WP_001175648.1.34948 WP_001175648.1.35006 WP_001175648.1.35202 WP_001175648.1.35365 WP_001175648.1.35376 WP_001175648.1.3539 WP_001175648.1.35465 WP_001175648.1.35468 WP_001175648.1.35581 WP_001175648.1.3560 WP_001175648.1.35604 WP_001175648.1.35653 WP_001175648.1.35922 WP_001175648.1.35942 WP_001175648.1.36042 WP_001175648.1.36070 WP_001175648.1.36071 WP_001175648.1.36094 WP_001175648.1.36166 WP_001175648.1.36182 WP_001175648.1.36393 WP_001175648.1.36412 WP_001175648.1.36500 WP_001175648.1.36507 WP_001175648.1.36523 WP_001175648.1.36610 WP_001175648.1.36627 WP_001175648.1.36628 WP_001175648.1.36707 WP_001175648.1.36806 WP_001175648.1.36812 WP_001175648.1.36826 WP_001175648.1.36925 WP_001175648.1.36975 WP_001175648.1.37020 WP_001175648.1.37046 WP_001175648.1.37057 WP_001175648.1.37099 WP_001175648.1.37252 WP_001175648.1.37329 WP_001175648.1.37334 WP_001175648.1.37352 WP_001175648.1.37371 WP_001175648.1.37476 WP_001175648.1.37538 WP_001175648.1.37554 WP_001175648.1.37634 WP_001175648.1.377 WP_001175648.1.3772 WP_001175648.1.37750 WP_001175648.1.37758 WP_001175648.1.37762 WP_001175648.1.37773 WP_001175648.1.37852 WP_001175648.1.37880 WP_001175648.1.37887 WP_001175648.1.37926 WP_001175648.1.37964 WP_001175648.1.38033 WP_001175648.1.38081 WP_001175648.1.38120 WP_001175648.1.38162 WP_001175648.1.38257 WP_001175648.1.38314 WP_001175648.1.38412 WP_001175648.1.38584 WP_001175648.1.38629 WP_001175648.1.38694 WP_001175648.1.38722 WP_001175648.1.38777 WP_001175648.1.38896 WP_001175648.1.38911 WP_001175648.1.38920 WP_001175648.1.38935 WP_001175648.1.38950 WP_001175648.1.39005 WP_001175648.1.39037 WP_001175648.1.3904 WP_001175648.1.39042 WP_001175648.1.39103 WP_001175648.1.39150 WP_001175648.1.39249 WP_001175648.1.39302 WP_001175648.1.39342 WP_001175648.1.39367 WP_001175648.1.39509 WP_001175648.1.3954 WP_001175648.1.39594 WP_001175648.1.39606 WP_001175648.1.39607 WP_001175648.1.39610 WP_001175648.1.39690 WP_001175648.1.3970 WP_001175648.1.39818 WP_001175648.1.39822 WP_001175648.1.40016 WP_001175648.1.40088 WP_001175648.1.40147 WP_001175648.1.4020 WP_001175648.1.40206 WP_001175648.1.40238 WP_001175648.1.40249 WP_001175648.1.40315 WP_001175648.1.40319 WP_001175648.1.40335 WP_001175648.1.40382 WP_001175648.1.40391 WP_001175648.1.40403 WP_001175648.1.40445 WP_001175648.1.4049 WP_001175648.1.40502 WP_001175648.1.40563 WP_001175648.1.40596 WP_001175648.1.40599 WP_001175648.1.40617 WP_001175648.1.40686 WP_001175648.1.40813 WP_001175648.1.4082 WP_001175648.1.40865 WP_001175648.1.41037 WP_001175648.1.41045 WP_001175648.1.41147 WP_001175648.1.41239 WP_001175648.1.41263 WP_001175648.1.41363 WP_001175648.1.41371 WP_001175648.1.41392 WP_001175648.1.41402 WP_001175648.1.41407 WP_001175648.1.41417 WP_001175648.1.4142 WP_001175648.1.41455 WP_001175648.1.41466 WP_001175648.1.41484 WP_001175648.1.41545 WP_001175648.1.41566 WP_001175648.1.41651 WP_001175648.1.41654 WP_001175648.1.41740 WP_001175648.1.41752 WP_001175648.1.41780 WP_001175648.1.41812 WP_001175648.1.41813 WP_001175648.1.41988 WP_001175648.1.42027 WP_001175648.1.42038 WP_001175648.1.4214 WP_001175648.1.42179 WP_001175648.1.42203 WP_001175648.1.4224 WP_001175648.1.42367 WP_001175648.1.42387 WP_001175648.1.42415 WP_001175648.1.42432 WP_001175648.1.42442 WP_001175648.1.42522 WP_001175648.1.42632 WP_001175648.1.42661 WP_001175648.1.42749 WP_001175648.1.42756 WP_001175648.1.42918 WP_001175648.1.42937 WP_001175648.1.42950 WP_001175648.1.42962 WP_001175648.1.43035 WP_001175648.1.43137 WP_001175648.1.43166 WP_001175648.1.43174 WP_001175648.1.43177 WP_001175648.1.43239 WP_001175648.1.43316 WP_001175648.1.43363 WP_001175648.1.43389 WP_001175648.1.4342 WP_001175648.1.43455 WP_001175648.1.43474 WP_001175648.1.43750 WP_001175648.1.43804 WP_001175648.1.44018 WP_001175648.1.44020 WP_001175648.1.44029 WP_001175648.1.44075 WP_001175648.1.44077 WP_001175648.1.44273 WP_001175648.1.44292 WP_001175648.1.44445 WP_001175648.1.44461 WP_001175648.1.4449 WP_001175648.1.44524 WP_001175648.1.44587 WP_001175648.1.44608 WP_001175648.1.4473 WP_001175648.1.44756 WP_001175648.1.44821 WP_001175648.1.44857 WP_001175648.1.45028 WP_001175648.1.45043 WP_001175648.1.45053 WP_001175648.1.45104 WP_001175648.1.45208 WP_001175648.1.45301 WP_001175648.1.45359 WP_001175648.1.45440 WP_001175648.1.45444 WP_001175648.1.4570 WP_001175648.1.45840 WP_001175648.1.45846 WP_001175648.1.45868 WP_001175648.1.45960 WP_001175648.1.45968 WP_001175648.1.4600 WP_001175648.1.46048 WP_001175648.1.46049 WP_001175648.1.46070 WP_001175648.1.46097 WP_001175648.1.46105 WP_001175648.1.4613 WP_001175648.1.46197 WP_001175648.1.46239 WP_001175648.1.46257 WP_001175648.1.46301 WP_001175648.1.46329 WP_001175648.1.4646 WP_001175648.1.46477 WP_001175648.1.46526 WP_001175648.1.46552 WP_001175648.1.4657 WP_001175648.1.46602 WP_001175648.1.46614 WP_001175648.1.46616 WP_001175648.1.46668 WP_001175648.1.46743 WP_001175648.1.46860 WP_001175648.1.46882 WP_001175648.1.46912 WP_001175648.1.46999 WP_001175648.1.47028 WP_001175648.1.47050 WP_001175648.1.47156 WP_001175648.1.47280 WP_001175648.1.47307 WP_001175648.1.47319 WP_001175648.1.47332 WP_001175648.1.47363 WP_001175648.1.4740 WP_001175648.1.47401 WP_001175648.1.47425 WP_001175648.1.47473 WP_001175648.1.47477 WP_001175648.1.47529 WP_001175648.1.47555 WP_001175648.1.47662 WP_001175648.1.47740 WP_001175648.1.47744 WP_001175648.1.47761 WP_001175648.1.47770 WP_001175648.1.4796 WP_001175648.1.47962 WP_001175648.1.48000 WP_001175648.1.48018 WP_001175648.1.48048 WP_001175648.1.48073 WP_001175648.1.48144 WP_001175648.1.48222 WP_001175648.1.48291 WP_001175648.1.48355 WP_001175648.1.48371 WP_001175648.1.48421 WP_001175648.1.48433 WP_001175648.1.48483 WP_001175648.1.48505 WP_001175648.1.4857 WP_001175648.1.48571 WP_001175648.1.48678 WP_001175648.1.48901 WP_001175648.1.48928 WP_001175648.1.49124 WP_001175648.1.49147 WP_001175648.1.49190 WP_001175648.1.49243 WP_001175648.1.49312 WP_001175648.1.49336 WP_001175648.1.49459 WP_001175648.1.49482 WP_001175648.1.49558 WP_001175648.1.497 WP_001175648.1.49712 WP_001175648.1.49722 WP_001175648.1.49774 WP_001175648.1.49861 WP_001175648.1.49879 WP_001175648.1.49950 WP_001175648.1.49954 WP_001175648.1.49987 WP_001175648.1.50036 WP_001175648.1.50113 WP_001175648.1.50119 WP_001175648.1.50182 WP_001175648.1.50353 WP_001175648.1.50361 WP_001175648.1.50412 WP_001175648.1.50418 WP_001175648.1.50616 WP_001175648.1.5064 WP_001175648.1.5067 WP_001175648.1.50715 WP_001175648.1.50725 WP_001175648.1.50939 WP_001175648.1.50969 WP_001175648.1.50996 WP_001175648.1.51013 WP_001175648.1.51109 WP_001175648.1.51175 WP_001175648.1.51260 WP_001175648.1.5128 WP_001175648.1.51323 WP_001175648.1.51325 WP_001175648.1.51430 WP_001175648.1.51441 WP_001175648.1.51462 WP_001175648.1.51490 WP_001175648.1.51525 WP_001175648.1.51537 WP_001175648.1.51539 WP_001175648.1.5157 WP_001175648.1.51580 WP_001175648.1.51587 WP_001175648.1.51629 WP_001175648.1.51707 WP_001175648.1.51837 WP_001175648.1.51899 WP_001175648.1.51988 WP_001175648.1.51999 WP_001175648.1.52171 WP_001175648.1.52200 WP_001175648.1.52249 WP_001175648.1.5227 WP_001175648.1.52272 WP_001175648.1.52378 WP_001175648.1.5239 WP_001175648.1.52419 WP_001175648.1.52612 WP_001175648.1.52691 WP_001175648.1.52735 WP_001175648.1.52762 WP_001175648.1.52777 WP_001175648.1.52780 WP_001175648.1.52801 WP_001175648.1.52846 WP_001175648.1.52881 WP_001175648.1.52908 WP_001175648.1.52913 WP_001175648.1.52962 WP_001175648.1.52995 WP_001175648.1.53027 WP_001175648.1.5310 WP_001175648.1.53155 WP_001175648.1.532 WP_001175648.1.53228 WP_001175648.1.53238 WP_001175648.1.53242 WP_001175648.1.53251 WP_001175648.1.53262 WP_001175648.1.53327 WP_001175648.1.53356 WP_001175648.1.53364 WP_001175648.1.53401 WP_001175648.1.5342 WP_001175648.1.53505 WP_001175648.1.53537 WP_001175648.1.53592 WP_001175648.1.53594 WP_001175648.1.53809 WP_001175648.1.53810 WP_001175648.1.53863 WP_001175648.1.5393 WP_001175648.1.53966 WP_001175648.1.53978 WP_001175648.1.54013 WP_001175648.1.54023 WP_001175648.1.54091 WP_001175648.1.54144 WP_001175648.1.54169 WP_001175648.1.54185 WP_001175648.1.54202 WP_001175648.1.54317 WP_001175648.1.54329 WP_001175648.1.54359 WP_001175648.1.54463 WP_001175648.1.54546 WP_001175648.1.54591 WP_001175648.1.5460 WP_001175648.1.54695 WP_001175648.1.5479 WP_001175648.1.54798 WP_001175648.1.54829 WP_001175648.1.54918 WP_001175648.1.54941 WP_001175648.1.54991 WP_001175648.1.55005 WP_001175648.1.55009 WP_001175648.1.55041 WP_001175648.1.55112 WP_001175648.1.55115 WP_001175648.1.55134 WP_001175648.1.55197 WP_001175648.1.55222 WP_001175648.1.55338 WP_001175648.1.55357 WP_001175648.1.55381 WP_001175648.1.55417 WP_001175648.1.55425 WP_001175648.1.55489 WP_001175648.1.55552 WP_001175648.1.55556 WP_001175648.1.55560 WP_001175648.1.55597 WP_001175648.1.55608 WP_001175648.1.5561 WP_001175648.1.5570 WP_001175648.1.55709 WP_001175648.1.55720 WP_001175648.1.55730 WP_001175648.1.55787 WP_001175648.1.55844 WP_001175648.1.55988 WP_001175648.1.56149 WP_001175648.1.5616 WP_001175648.1.56193 WP_001175648.1.56302 WP_001175648.1.56390 WP_001175648.1.5646 WP_001175648.1.56513 WP_001175648.1.56528 WP_001175648.1.56543 WP_001175648.1.56586 WP_001175648.1.56680 WP_001175648.1.56689 WP_001175648.1.5670 WP_001175648.1.56786 WP_001175648.1.56799 WP_001175648.1.56835 WP_001175648.1.56871 WP_001175648.1.56882 WP_001175648.1.56932 WP_001175648.1.56934 WP_001175648.1.57051 WP_001175648.1.57072 WP_001175648.1.57086 WP_001175648.1.57100 WP_001175648.1.57124 WP_001175648.1.57216 WP_001175648.1.57222 WP_001175648.1.57281 WP_001175648.1.57487 WP_001175648.1.57538 WP_001175648.1.5755 WP_001175648.1.57558 WP_001175648.1.57629 WP_001175648.1.57638 WP_001175648.1.57659 WP_001175648.1.57738 WP_001175648.1.57812 WP_001175648.1.57904 WP_001175648.1.58001 WP_001175648.1.58022 WP_001175648.1.58045 WP_001175648.1.58060 WP_001175648.1.58080 WP_001175648.1.58146 WP_001175648.1.58163 WP_001175648.1.58206 WP_001175648.1.58226 WP_001175648.1.58371 WP_001175648.1.58384 WP_001175648.1.5842 WP_001175648.1.58420 WP_001175648.1.58445 WP_001175648.1.58507 WP_001175648.1.58514 WP_001175648.1.58528 WP_001175648.1.58547 WP_001175648.1.58572 WP_001175648.1.58622 WP_001175648.1.58705 WP_001175648.1.58837 WP_001175648.1.58870 WP_001175648.1.58977 WP_001175648.1.59026 WP_001175648.1.59047 WP_001175648.1.5906 WP_001175648.1.59119 WP_001175648.1.59174 WP_001175648.1.59190 WP_001175648.1.59280 WP_001175648.1.59293 WP_001175648.1.59395 WP_001175648.1.59413 WP_001175648.1.59423 WP_001175648.1.59434 WP_001175648.1.59621 WP_001175648.1.59638 WP_001175648.1.59699 WP_001175648.1.59730 WP_001175648.1.59737 WP_001175648.1.59756 WP_001175648.1.59781 WP_001175648.1.59782 WP_001175648.1.59823 WP_001175648.1.60095 WP_001175648.1.6022 WP_001175648.1.60228 WP_001175648.1.60325 WP_001175648.1.60387 WP_001175648.1.60436 WP_001175648.1.60477 WP_001175648.1.60491 WP_001175648.1.60576 WP_001175648.1.6059 WP_001175648.1.6064 WP_001175648.1.60732 WP_001175648.1.60835 WP_001175648.1.60927 WP_001175648.1.61005 WP_001175648.1.61035 WP_001175648.1.61058 WP_001175648.1.6110 WP_001175648.1.61102 WP_001175648.1.61112 WP_001175648.1.61174 WP_001175648.1.61225 WP_001175648.1.61292 WP_001175648.1.61398 WP_001175648.1.61512 WP_001175648.1.61551 WP_001175648.1.61608 WP_001175648.1.61636 WP_001175648.1.61758 WP_001175648.1.61806 WP_001175648.1.61926 WP_001175648.1.61939 WP_001175648.1.61957 WP_001175648.1.62041 WP_001175648.1.6212 WP_001175648.1.62264 WP_001175648.1.62290 WP_001175648.1.62296 WP_001175648.1.62337 WP_001175648.1.62358 WP_001175648.1.62447 WP_001175648.1.62460 WP_001175648.1.62487 WP_001175648.1.62514 WP_001175648.1.62529 WP_001175648.1.62646 WP_001175648.1.62681 WP_001175648.1.62762 WP_001175648.1.62769 WP_001175648.1.62787 WP_001175648.1.62818 WP_001175648.1.62850 WP_001175648.1.62851 WP_001175648.1.6293 WP_001175648.1.62959 WP_001175648.1.6299 WP_001175648.1.63177 WP_001175648.1.63189 WP_001175648.1.63246 WP_001175648.1.63287 WP_001175648.1.63370 WP_001175648.1.63374 WP_001175648.1.63393 WP_001175648.1.63437 WP_001175648.1.63466 WP_001175648.1.63467 WP_001175648.1.63478 WP_001175648.1.63491 WP_001175648.1.63556 WP_001175648.1.63576 WP_001175648.1.63666 WP_001175648.1.63679 WP_001175648.1.63703 WP_001175648.1.63746 WP_001175648.1.63964 WP_001175648.1.64008 WP_001175648.1.64050 WP_001175648.1.64074 WP_001175648.1.6416 WP_001175648.1.64175 WP_001175648.1.64286 WP_001175648.1.64321 WP_001175648.1.64337 WP_001175648.1.64356 WP_001175648.1.64391 WP_001175648.1.64438 WP_001175648.1.64458 WP_001175648.1.64528 WP_001175648.1.64657 WP_001175648.1.64693 WP_001175648.1.64707 WP_001175648.1.64746 WP_001175648.1.64970 WP_001175648.1.65023 WP_001175648.1.65040 WP_001175648.1.65097 WP_001175648.1.651 WP_001175648.1.65151 WP_001175648.1.65155 WP_001175648.1.65179 WP_001175648.1.65206 WP_001175648.1.65306 WP_001175648.1.6537 WP_001175648.1.65370 WP_001175648.1.654 WP_001175648.1.65408 WP_001175648.1.65413 WP_001175648.1.65493 WP_001175648.1.65531 WP_001175648.1.65672 WP_001175648.1.65762 WP_001175648.1.65962 WP_001175648.1.6599 WP_001175648.1.65991 WP_001175648.1.66001 WP_001175648.1.66007 WP_001175648.1.6604 WP_001175648.1.66094 WP_001175648.1.66181 WP_001175648.1.66197 WP_001175648.1.66251 WP_001175648.1.66288 WP_001175648.1.6645 WP_001175648.1.66550 WP_001175648.1.66559 WP_001175648.1.66579 WP_001175648.1.66624 WP_001175648.1.66644 WP_001175648.1.66758 WP_001175648.1.66783 WP_001175648.1.66795 WP_001175648.1.66849 WP_001175648.1.66926 WP_001175648.1.66948 WP_001175648.1.67018 WP_001175648.1.67026 WP_001175648.1.67102 WP_001175648.1.67120 WP_001175648.1.67194 WP_001175648.1.6723 WP_001175648.1.67293 WP_001175648.1.6735 WP_001175648.1.67383 WP_001175648.1.67454 WP_001175648.1.67522 WP_001175648.1.67549 WP_001175648.1.67581 WP_001175648.1.67701 WP_001175648.1.67724 WP_001175648.1.67732 WP_001175648.1.67788 WP_001175648.1.678 WP_001175648.1.67841 WP_001175648.1.68011 WP_001175648.1.6802 WP_001175648.1.68025 WP_001175648.1.68039 WP_001175648.1.68079 WP_001175648.1.68175 WP_001175648.1.68300 WP_001175648.1.68336 WP_001175648.1.68347 WP_001175648.1.68442 WP_001175648.1.68566 WP_001175648.1.6860 WP_001175648.1.68695 WP_001175648.1.68751 WP_001175648.1.68801 WP_001175648.1.68865 WP_001175648.1.68873 WP_001175648.1.68956 WP_001175648.1.69098 WP_001175648.1.69126 WP_001175648.1.69127 WP_001175648.1.69144 WP_001175648.1.69247 WP_001175648.1.69390 WP_001175648.1.694 WP_001175648.1.69472 WP_001175648.1.69551 WP_001175648.1.69593 WP_001175648.1.69786 WP_001175648.1.69887 WP_001175648.1.69972 WP_001175648.1.70063 WP_001175648.1.70149 WP_001175648.1.70357 WP_001175648.1.70477 WP_001175648.1.70492 WP_001175648.1.7052 WP_001175648.1.70592 WP_001175648.1.70628 WP_001175648.1.70694 WP_001175648.1.70748 WP_001175648.1.70801 WP_001175648.1.7090 WP_001175648.1.70900 WP_001175648.1.70967 WP_001175648.1.71042 WP_001175648.1.71062 WP_001175648.1.71109 WP_001175648.1.71134 WP_001175648.1.71147 WP_001175648.1.71192 WP_001175648.1.71221 WP_001175648.1.71272 WP_001175648.1.71275 WP_001175648.1.71339 WP_001175648.1.71354 WP_001175648.1.71403 WP_001175648.1.71540 WP_001175648.1.71603 WP_001175648.1.71712 WP_001175648.1.71757 WP_001175648.1.71856 WP_001175648.1.71874 WP_001175648.1.7192 WP_001175648.1.71987 WP_001175648.1.72021 WP_001175648.1.72033 WP_001175648.1.72053 WP_001175648.1.72153 WP_001175648.1.7225 WP_001175648.1.72270 WP_001175648.1.72279 WP_001175648.1.72493 WP_001175648.1.72521 WP_001175648.1.72522 WP_001175648.1.72535 WP_001175648.1.72608 WP_001175648.1.72643 WP_001175648.1.72652 WP_001175648.1.72663 WP_001175648.1.72695 WP_001175648.1.72725 WP_001175648.1.72729 WP_001175648.1.72751 WP_001175648.1.72758 WP_001175648.1.7277 WP_001175648.1.72837 WP_001175648.1.72858 WP_001175648.1.73032 WP_001175648.1.73072 WP_001175648.1.73197 WP_001175648.1.73249 WP_001175648.1.73251 WP_001175648.1.73257 WP_001175648.1.73259 WP_001175648.1.73326 WP_001175648.1.73340 WP_001175648.1.73349 WP_001175648.1.7349 WP_001175648.1.73709 WP_001175648.1.73797 WP_001175648.1.73807 WP_001175648.1.73843 WP_001175648.1.73882 WP_001175648.1.73908 WP_001175648.1.73992 WP_001175648.1.73995 WP_001175648.1.74051 WP_001175648.1.74123 WP_001175648.1.7413 WP_001175648.1.74156 WP_001175648.1.7424 WP_001175648.1.7425 WP_001175648.1.74423 WP_001175648.1.74431 WP_001175648.1.74444 WP_001175648.1.74478 WP_001175648.1.74491 WP_001175648.1.74501 WP_001175648.1.74513 WP_001175648.1.74532 WP_001175648.1.74624 WP_001175648.1.74652 WP_001175648.1.74670 WP_001175648.1.74687 WP_001175648.1.74689 WP_001175648.1.74705 WP_001175648.1.74735 WP_001175648.1.74752 WP_001175648.1.7478 WP_001175648.1.74844 WP_001175648.1.74852 WP_001175648.1.74854 WP_001175648.1.74885 WP_001175648.1.74889 WP_001175648.1.74895 WP_001175648.1.75021 WP_001175648.1.75050 WP_001175648.1.75145 WP_001175648.1.75149 WP_001175648.1.75181 WP_001175648.1.75272 WP_001175648.1.75360 WP_001175648.1.75428 WP_001175648.1.75465 WP_001175648.1.75515 WP_001175648.1.75529 WP_001175648.1.75588 WP_001175648.1.75594 WP_001175648.1.75687 WP_001175648.1.75696 WP_001175648.1.75758 WP_001175648.1.75973 WP_001175648.1.75999 WP_001175648.1.76009 WP_001175648.1.76087 WP_001175648.1.76129 WP_001175648.1.76361 WP_001175648.1.76384 WP_001175648.1.76595 WP_001175648.1.7661 WP_001175648.1.76656 WP_001175648.1.76707 WP_001175648.1.76712 WP_001175648.1.76840 WP_001175648.1.76909 WP_001175648.1.76918 WP_001175648.1.76933 WP_001175648.1.76965 WP_001175648.1.76966 WP_001175648.1.77015 WP_001175648.1.77022 WP_001175648.1.77070 WP_001175648.1.77147 WP_001175648.1.77162 WP_001175648.1.77163 WP_001175648.1.77258 WP_001175648.1.7728 WP_001175648.1.77284 WP_001175648.1.77291 WP_001175648.1.7731 WP_001175648.1.77341 WP_001175648.1.77437 WP_001175648.1.77452 WP_001175648.1.77462 WP_001175648.1.77477 WP_001175648.1.77503 WP_001175648.1.77581 WP_001175648.1.77626 WP_001175648.1.77648 WP_001175648.1.77767 WP_001175648.1.7781 WP_001175648.1.77826 WP_001175648.1.77833 WP_001175648.1.77929 WP_001175648.1.77949 WP_001175648.1.77999 WP_001175648.1.7808 WP_001175648.1.78099 WP_001175648.1.78102 WP_001175648.1.78297 WP_001175648.1.78337 WP_001175648.1.78445 WP_001175648.1.78515 WP_001175648.1.78586 WP_001175648.1.78610 WP_001175648.1.78645 WP_001175648.1.78683 WP_001175648.1.78698 WP_001175648.1.78718 WP_001175648.1.78757 WP_001175648.1.7883 WP_001175648.1.78843 WP_001175648.1.78854 WP_001175648.1.78891 WP_001175648.1.78919 WP_001175648.1.78966 WP_001175648.1.7898 WP_001175648.1.79065 WP_001175648.1.79067 WP_001175648.1.79075 WP_001175648.1.79346 WP_001175648.1.79356 WP_001175648.1.7937 WP_001175648.1.79391 WP_001175648.1.79540 WP_001175648.1.79591 WP_001175648.1.79606 WP_001175648.1.79713 WP_001175648.1.79800 WP_001175648.1.79816 WP_001175648.1.79824 WP_001175648.1.7985 WP_001175648.1.79877 WP_001175648.1.79905 WP_001175648.1.7993 WP_001175648.1.79930 WP_001175648.1.79932 WP_001175648.1.80060 WP_001175648.1.80071 WP_001175648.1.80112 WP_001175648.1.80310 WP_001175648.1.80426 WP_001175648.1.80484 WP_001175648.1.80612 WP_001175648.1.80626 WP_001175648.1.80662 WP_001175648.1.80666 WP_001175648.1.80709 WP_001175648.1.80737 WP_001175648.1.80754 WP_001175648.1.80756 WP_001175648.1.80789 WP_001175648.1.80945 WP_001175648.1.80946 WP_001175648.1.80983 WP_001175648.1.80985 WP_001175648.1.81026 WP_001175648.1.81054 WP_001175648.1.811 WP_001175648.1.81104 WP_001175648.1.81165 WP_001175648.1.81182 WP_001175648.1.8121 WP_001175648.1.8129 WP_001175648.1.81316 WP_001175648.1.81391 WP_001175648.1.81438 WP_001175648.1.81469 WP_001175648.1.81475 WP_001175648.1.81484 WP_001175648.1.81618 WP_001175648.1.81625 WP_001175648.1.81914 WP_001175648.1.81972 WP_001175648.1.82 WP_001175648.1.82062 WP_001175648.1.82074 WP_001175648.1.82137 WP_001175648.1.82217 WP_001175648.1.82239 WP_001175648.1.82240 WP_001175648.1.82242 WP_001175648.1.82246 WP_001175648.1.82326 WP_001175648.1.82439 WP_001175648.1.82485 WP_001175648.1.82499 WP_001175648.1.82626 WP_001175648.1.82682 WP_001175648.1.8277 WP_001175648.1.82799 WP_001175648.1.82831 WP_001175648.1.82853 WP_001175648.1.82902 WP_001175648.1.83035 WP_001175648.1.8306 WP_001175648.1.831 WP_001175648.1.83205 WP_001175648.1.83347 WP_001175648.1.83481 WP_001175648.1.83564 WP_001175648.1.83584 WP_001175648.1.83684 WP_001175648.1.83820 WP_001175648.1.84060 WP_001175648.1.84172 WP_001175648.1.84185 WP_001175648.1.84313 WP_001175648.1.84339 WP_001175648.1.84348 WP_001175648.1.84484 WP_001175648.1.84511 WP_001175648.1.84656 WP_001175648.1.84668 WP_001175648.1.8470 WP_001175648.1.84841 WP_001175648.1.84850 WP_001175648.1.84875 WP_001175648.1.84894 WP_001175648.1.84929 WP_001175648.1.84941 WP_001175648.1.85011 WP_001175648.1.85098 WP_001175648.1.85112 WP_001175648.1.85129 WP_001175648.1.85175 WP_001175648.1.85500 WP_001175648.1.85525 WP_001175648.1.85657 WP_001175648.1.85762 WP_001175648.1.8579 WP_001175648.1.85939 WP_001175648.1.85944 WP_001175648.1.86016 WP_001175648.1.8607 WP_001175648.1.86149 WP_001175648.1.86210 WP_001175648.1.86266 WP_001175648.1.86283 WP_001175648.1.86307 WP_001175648.1.86355 WP_001175648.1.86371 WP_001175648.1.86393 WP_001175648.1.86454 WP_001175648.1.86492 WP_001175648.1.8652 WP_001175648.1.86583 WP_001175648.1.86598 WP_001175648.1.86617 WP_001175648.1.86640 WP_001175648.1.86707 WP_001175648.1.86833 WP_001175648.1.8687 WP_001175648.1.86956 WP_001175648.1.87075 WP_001175648.1.87109 WP_001175648.1.87189 WP_001175648.1.87249 WP_001175648.1.87310 WP_001175648.1.87358 WP_001175648.1.87400 WP_001175648.1.87465 WP_001175648.1.87557 WP_001175648.1.87568 WP_001175648.1.87694 WP_001175648.1.87721 WP_001175648.1.87726 WP_001175648.1.87788 WP_001175648.1.87789 WP_001175648.1.87822 WP_001175648.1.87834 WP_001175648.1.87919 WP_001175648.1.87973 WP_001175648.1.87976 WP_001175648.1.87980 WP_001175648.1.87989 WP_001175648.1.88020 WP_001175648.1.88088 WP_001175648.1.88110 WP_001175648.1.88149 WP_001175648.1.88155 WP_001175648.1.88285 WP_001175648.1.88376 WP_001175648.1.88379 WP_001175648.1.88427 WP_001175648.1.88462 WP_001175648.1.88598 WP_001175648.1.88603 WP_001175648.1.88631 WP_001175648.1.88646 WP_001175648.1.88709 WP_001175648.1.88710 WP_001175648.1.88732 WP_001175648.1.88757 WP_001175648.1.88883 WP_001175648.1.88997 WP_001175648.1.8906 WP_001175648.1.89197 WP_001175648.1.89200 WP_001175648.1.89255 WP_001175648.1.89305 WP_001175648.1.894 WP_001175648.1.89432 WP_001175648.1.8945 WP_001175648.1.89479 WP_001175648.1.89492 WP_001175648.1.89601 WP_001175648.1.89710 WP_001175648.1.89768 WP_001175648.1.89788 WP_001175648.1.89818 WP_001175648.1.89839 WP_001175648.1.89895 WP_001175648.1.89915 WP_001175648.1.89918 WP_001175648.1.89920 WP_001175648.1.9010 WP_001175648.1.90128 WP_001175648.1.90146 WP_001175648.1.90205 WP_001175648.1.90270 WP_001175648.1.90332 WP_001175648.1.90441 WP_001175648.1.90467 WP_001175648.1.90547 WP_001175648.1.9059 WP_001175648.1.90591 WP_001175648.1.9061 WP_001175648.1.90626 WP_001175648.1.90706 WP_001175648.1.90799 WP_001175648.1.9081 WP_001175648.1.90813 WP_001175648.1.90822 WP_001175648.1.90834 WP_001175648.1.90856 WP_001175648.1.90864 WP_001175648.1.90873 WP_001175648.1.90890 WP_001175648.1.90979 WP_001175648.1.91266 WP_001175648.1.91290 WP_001175648.1.91397 WP_001175648.1.91485 WP_001175648.1.91511 WP_001175648.1.91516 WP_001175648.1.91565 WP_001175648.1.9157 WP_001175648.1.91596 WP_001175648.1.91643 WP_001175648.1.91672 WP_001175648.1.91685 WP_001175648.1.91777 WP_001175648.1.91787 WP_001175648.1.91850 WP_001175648.1.91951 WP_001175648.1.91959 WP_001175648.1.92014 WP_001175648.1.92031 WP_001175648.1.92048 WP_001175648.1.92058 WP_001175648.1.921 WP_001175648.1.92102 WP_001175648.1.92215 WP_001175648.1.92311 WP_001175648.1.92434 WP_001175648.1.92532 WP_001175648.1.9255 WP_001175648.1.92577 WP_001175648.1.9264 WP_001175648.1.9266 WP_001175648.1.92668 WP_001175648.1.92693 WP_001175648.1.92708 WP_001175648.1.92719 WP_001175648.1.92780 WP_001175648.1.92953 WP_001175648.1.93005 WP_001175648.1.93016 WP_001175648.1.93100 WP_001175648.1.93252 WP_001175648.1.93379 WP_001175648.1.93388 WP_001175648.1.93463 WP_001175648.1.93509 WP_001175648.1.93629 WP_001175648.1.93637 WP_001175648.1.93733 WP_001175648.1.93743 WP_001175648.1.93800 WP_001175648.1.93873 WP_001175648.1.93877 WP_001175648.1.93918 WP_001175648.1.93951 WP_001175648.1.94008 WP_001175648.1.94011 WP_001175648.1.94156 WP_001175648.1.94232 WP_001175648.1.94298 WP_001175648.1.94317 WP_001175648.1.94353 WP_001175648.1.94404 WP_001175648.1.94468 WP_001175648.1.94548 WP_001175648.1.94578 WP_001175648.1.94808 WP_001175648.1.94822 WP_001175648.1.94880 WP_001175648.1.94889 WP_001175648.1.94903 WP_001175648.1.94935 WP_001175648.1.94993 WP_001175648.1.95005 WP_001175648.1.9513 WP_001175648.1.95161 WP_001175648.1.95243 WP_001175648.1.95244 WP_001175648.1.95368 WP_001175648.1.95381 WP_001175648.1.95390 WP_001175648.1.95400 WP_001175648.1.95424 WP_001175648.1.95438 WP_001175648.1.95490 WP_001175648.1.95521 WP_001175648.1.9559 WP_001175648.1.95604 WP_001175648.1.95611 WP_001175648.1.95655 WP_001175648.1.95771 WP_001175648.1.95800 WP_001175648.1.95824 WP_001175648.1.95916 WP_001175648.1.95932 WP_001175648.1.960 WP_001175648.1.96053 WP_001175648.1.96066 WP_001175648.1.96114 WP_001175648.1.96177 WP_001175648.1.96222 WP_001175648.1.96341 WP_001175648.1.96457 WP_001175648.1.96479 WP_001175648.1.96494 WP_001175648.1.9657 WP_001175648.1.96585 WP_001175648.1.9661 WP_001175648.1.96659 WP_001175648.1.96743 WP_001175648.1.96817 WP_001175648.1.9690 WP_001175648.1.9691 WP_001175648.1.96924 WP_001175648.1.96944 WP_001175648.1.97027 WP_001175648.1.97059 WP_001175648.1.97119 WP_001175648.1.97200 WP_001175648.1.97238 WP_001175648.1.97248 WP_001175648.1.97344 WP_001175648.1.97356 WP_001175648.1.97360 WP_001175648.1.97361 WP_001175648.1.97421 WP_001175648.1.97439 WP_001175648.1.97490 WP_001175648.1.97538 WP_001175648.1.97544 WP_001175648.1.97560 WP_001175648.1.97685 WP_001175648.1.97705 WP_001175648.1.97822 WP_001175648.1.97932 WP_001175648.1.97937 WP_001175648.1.97962 WP_001175648.1.97996 WP_001175648.1.98026 WP_001175648.1.9803 WP_001175648.1.98082 WP_001175648.1.98220 WP_001175648.1.98232 WP_001175648.1.98239 WP_001175648.1.98241 WP_001175648.1.98292 WP_001175648.1.98301 WP_001175648.1.98355 WP_001175648.1.9844 WP_001175648.1.98578 WP_001175648.1.9858 WP_001175648.1.98614 WP_001175648.1.9864 WP_001175648.1.98654 WP_001175648.1.98665 WP_001175648.1.98702 WP_001175648.1.98875 WP_001175648.1.99046 WP_001175648.1.99209 WP_001175648.1.99246 WP_001175648.1.99265 WP_001175648.1.99292 WP_001175648.1.99295 WP_001175648.1.99304 WP_001175648.1.99334 WP_001175648.1.99345 WP_001175648.1.99361 WP_001175648.1.9940 WP_001175648.1.99446 WP_001175648.1.99486 WP_001175648.1.99511 WP_001175648.1.99562 WP_001175648.1.99592 WP_001175648.1.99619 WP_001175648.1.99666 WP_001175648.1.99804 WP_001175648.1.99827 WP_001175648.1.99869 YP_006778161.1.12065 gi|407481012|ref|YP_006778161.1| gi|378712106|ref|YP_005276999.1| gi|443618483|ref|YP_007382339.1| gi|157155139|ref|YP_001463757.1| gi|386710324|ref|YP_006174045.1| gi|218554960|ref|YP_002387873.1| gi|407470326|ref|YP_006783231.1| gi|378712106|ref|YP_005276999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]