SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218696856|ref|YP_002404523.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218696856|ref|YP_002404523.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily SIS domain 7.28e-52
Family mono-SIS domain 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218696856|ref|YP_002404523.1|
Sequence length 196
Comment DnaA initiator-associating protein DiaA [Escherichia coli 55989]
Sequence
MQERIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEVYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQDV
Download sequence
Identical sequences A0A027U0B7 A0A028A9U2 A0A028EDG4 A0A029HJF5 A0A029IL58 A0A062Y0I3 A0A064TCU6 A0A073FRT6 A0A073H684 A0A073UPU7 A0A074HTQ2 A0A080FKY4 A0A0A8UEF6 A0A0E0VA38 A0A0E0XVG8 A0A0E2L2D8 A0A0G3KC49 A0A0H3EP30 A0A0J3VPD7 A0A0K9THG1 A0A170N777 A0A192CD43 A0A1E2VQI5 A0A1E3N0W7 A0A1H0IU31 A0A1S6TFZ5 A0A1X3I301 A0A1X3K6P9 A0A1X3KYH2 A0A1X3LT09 A0A222QRH4 A0A237LJ05 A1AG54 A7ZS45 B1LFQ0 B7LH87 B7LMT6 B7M057 B7MB70 B7N0T4 B7NDD3 B7NKL8 B7UJ45 C8TXE6 C8UGA8 D3GWW2 D6I1D3 D6JF26 D7X656 D7ZEJ7 D8A8T9 D8EB57 E0J2U3 E3XTF6 E9XGD1 E9YUQ2 F4T3H0 F4V6P8 F4VJF4 H4IGR4 H4IXH1 H4KMC6 H4LHK1 I0VVH7 I2REB7 I2UH98 I2WYX5 K4X9U2 K4XPS2 L2XBJ6 L3NXT3 L3PZZ5 L3QE73 L4IZI5 Q0TCW0 Q1R6J2 Q8FD98 S0VJG9 S0XA56 S0YF52 S1NYX9 T5UC15 T6A276 T6HAI1 T6LUA9 T9A3C4 U9Y9N5 V0AHE2 V0SYE9 V0V5T6 V0X7D5 V0ZIS8 V2TDM3 V6FWS7 V8FIT9 V8KLA5 W1X7S1 W8ZNE5
gi|218696856|ref|YP_002404523.1| gi|386711058|ref|YP_006174779.1| gi|157155255|ref|YP_001464624.1| gi|218701920|ref|YP_002409549.1| gi|218560221|ref|YP_002393134.1| gi|410480779|ref|YP_006768325.1| gi|387618448|ref|YP_006121470.1| gi|544391636|ref|YP_008566317.1| gi|378711394|ref|YP_005276287.1| gi|407480219|ref|YP_006777368.1| gi|170682125|ref|YP_001745422.1| gi|215488468|ref|YP_002330899.1| WP_001158035.1.100014 WP_001158035.1.100052 WP_001158035.1.100066 WP_001158035.1.100138 WP_001158035.1.100151 WP_001158035.1.100185 WP_001158035.1.100194 WP_001158035.1.100220 WP_001158035.1.100227 WP_001158035.1.100252 WP_001158035.1.100281 WP_001158035.1.100283 WP_001158035.1.100304 WP_001158035.1.100306 WP_001158035.1.100425 WP_001158035.1.100474 WP_001158035.1.100499 WP_001158035.1.100531 WP_001158035.1.100543 WP_001158035.1.100571 WP_001158035.1.10068 WP_001158035.1.100688 WP_001158035.1.100689 WP_001158035.1.100718 WP_001158035.1.100735 WP_001158035.1.100738 WP_001158035.1.100752 WP_001158035.1.100778 WP_001158035.1.100796 WP_001158035.1.10080 WP_001158035.1.100836 WP_001158035.1.100867 WP_001158035.1.100898 WP_001158035.1.100916 WP_001158035.1.100933 WP_001158035.1.100950 WP_001158035.1.100959 WP_001158035.1.10100 WP_001158035.1.101052 WP_001158035.1.101087 WP_001158035.1.1011 WP_001158035.1.101110 WP_001158035.1.101148 WP_001158035.1.101152 WP_001158035.1.101157 WP_001158035.1.101216 WP_001158035.1.101257 WP_001158035.1.10126 WP_001158035.1.101289 WP_001158035.1.10131 WP_001158035.1.101359 WP_001158035.1.10138 WP_001158035.1.101399 WP_001158035.1.101418 WP_001158035.1.101429 WP_001158035.1.101430 WP_001158035.1.101436 WP_001158035.1.101439 WP_001158035.1.101445 WP_001158035.1.101468 WP_001158035.1.10154 WP_001158035.1.101586 WP_001158035.1.101630 WP_001158035.1.101651 WP_001158035.1.101653 WP_001158035.1.101668 WP_001158035.1.101693 WP_001158035.1.101694 WP_001158035.1.101700 WP_001158035.1.101727 WP_001158035.1.10173 WP_001158035.1.101769 WP_001158035.1.101786 WP_001158035.1.10181 WP_001158035.1.101840 WP_001158035.1.101845 WP_001158035.1.101855 WP_001158035.1.101865 WP_001158035.1.10190 WP_001158035.1.101913 WP_001158035.1.101926 WP_001158035.1.101932 WP_001158035.1.101947 WP_001158035.1.101948 WP_001158035.1.101952 WP_001158035.1.101962 WP_001158035.1.101984 WP_001158035.1.102036 WP_001158035.1.102069 WP_001158035.1.102076 WP_001158035.1.102104 WP_001158035.1.102106 WP_001158035.1.102122 WP_001158035.1.102144 WP_001158035.1.10326 WP_001158035.1.10379 WP_001158035.1.10381 WP_001158035.1.10400 WP_001158035.1.10461 WP_001158035.1.10492 WP_001158035.1.10538 WP_001158035.1.10573 WP_001158035.1.10579 WP_001158035.1.10605 WP_001158035.1.10607 WP_001158035.1.10651 WP_001158035.1.10673 WP_001158035.1.10697 WP_001158035.1.10705 WP_001158035.1.1073 WP_001158035.1.1074 WP_001158035.1.10744 WP_001158035.1.10748 WP_001158035.1.10763 WP_001158035.1.10786 WP_001158035.1.10787 WP_001158035.1.10798 WP_001158035.1.10809 WP_001158035.1.10814 WP_001158035.1.10842 WP_001158035.1.10849 WP_001158035.1.10869 WP_001158035.1.10989 WP_001158035.1.11032 WP_001158035.1.11057 WP_001158035.1.11091 WP_001158035.1.11113 WP_001158035.1.112 WP_001158035.1.11217 WP_001158035.1.1122 WP_001158035.1.11250 WP_001158035.1.11265 WP_001158035.1.11285 WP_001158035.1.11315 WP_001158035.1.11399 WP_001158035.1.11408 WP_001158035.1.11411 WP_001158035.1.11467 WP_001158035.1.11519 WP_001158035.1.11524 WP_001158035.1.11531 WP_001158035.1.11575 WP_001158035.1.11607 WP_001158035.1.11608 WP_001158035.1.11612 WP_001158035.1.11616 WP_001158035.1.11699 WP_001158035.1.11748 WP_001158035.1.11759 WP_001158035.1.11801 WP_001158035.1.11949 WP_001158035.1.11956 WP_001158035.1.11981 WP_001158035.1.11985 WP_001158035.1.12009 WP_001158035.1.12010 WP_001158035.1.12050 WP_001158035.1.12076 WP_001158035.1.12088 WP_001158035.1.12111 WP_001158035.1.12115 WP_001158035.1.12151 WP_001158035.1.12157 WP_001158035.1.12174 WP_001158035.1.12230 WP_001158035.1.12268 WP_001158035.1.12279 WP_001158035.1.12295 WP_001158035.1.12320 WP_001158035.1.12342 WP_001158035.1.12344 WP_001158035.1.1242 WP_001158035.1.12459 WP_001158035.1.12566 WP_001158035.1.12574 WP_001158035.1.12645 WP_001158035.1.12679 WP_001158035.1.12697 WP_001158035.1.12709 WP_001158035.1.12717 WP_001158035.1.12743 WP_001158035.1.12749 WP_001158035.1.12761 WP_001158035.1.12763 WP_001158035.1.1278 WP_001158035.1.12781 WP_001158035.1.12826 WP_001158035.1.12830 WP_001158035.1.12893 WP_001158035.1.12911 WP_001158035.1.12915 WP_001158035.1.12917 WP_001158035.1.12944 WP_001158035.1.1295 WP_001158035.1.12956 WP_001158035.1.12976 WP_001158035.1.12991 WP_001158035.1.1308 WP_001158035.1.13117 WP_001158035.1.13162 WP_001158035.1.13181 WP_001158035.1.13222 WP_001158035.1.1323 WP_001158035.1.13271 WP_001158035.1.13272 WP_001158035.1.13295 WP_001158035.1.13301 WP_001158035.1.13409 WP_001158035.1.1343 WP_001158035.1.13437 WP_001158035.1.13469 WP_001158035.1.13473 WP_001158035.1.13626 WP_001158035.1.13656 WP_001158035.1.13662 WP_001158035.1.13778 WP_001158035.1.13934 WP_001158035.1.13944 WP_001158035.1.14023 WP_001158035.1.14042 WP_001158035.1.14058 WP_001158035.1.14062 WP_001158035.1.14070 WP_001158035.1.14144 WP_001158035.1.14164 WP_001158035.1.14245 WP_001158035.1.14304 WP_001158035.1.14322 WP_001158035.1.14331 WP_001158035.1.14371 WP_001158035.1.14389 WP_001158035.1.14398 WP_001158035.1.14417 WP_001158035.1.14432 WP_001158035.1.14445 WP_001158035.1.14493 WP_001158035.1.14506 WP_001158035.1.14508 WP_001158035.1.14509 WP_001158035.1.14538 WP_001158035.1.14581 WP_001158035.1.14605 WP_001158035.1.14607 WP_001158035.1.14616 WP_001158035.1.14672 WP_001158035.1.14693 WP_001158035.1.14712 WP_001158035.1.14746 WP_001158035.1.14749 WP_001158035.1.14807 WP_001158035.1.14914 WP_001158035.1.14934 WP_001158035.1.14935 WP_001158035.1.14946 WP_001158035.1.14956 WP_001158035.1.14963 WP_001158035.1.14993 WP_001158035.1.15020 WP_001158035.1.15087 WP_001158035.1.15090 WP_001158035.1.1510 WP_001158035.1.15138 WP_001158035.1.15193 WP_001158035.1.15221 WP_001158035.1.1524 WP_001158035.1.15274 WP_001158035.1.15277 WP_001158035.1.15282 WP_001158035.1.15290 WP_001158035.1.15300 WP_001158035.1.15304 WP_001158035.1.15335 WP_001158035.1.15347 WP_001158035.1.15420 WP_001158035.1.1543 WP_001158035.1.15444 WP_001158035.1.15469 WP_001158035.1.15496 WP_001158035.1.1550 WP_001158035.1.15528 WP_001158035.1.15593 WP_001158035.1.1561 WP_001158035.1.15624 WP_001158035.1.15654 WP_001158035.1.15752 WP_001158035.1.1582 WP_001158035.1.15855 WP_001158035.1.15857 WP_001158035.1.15863 WP_001158035.1.15869 WP_001158035.1.15906 WP_001158035.1.15916 WP_001158035.1.15949 WP_001158035.1.15951 WP_001158035.1.15983 WP_001158035.1.15984 WP_001158035.1.15990 WP_001158035.1.16010 WP_001158035.1.16014 WP_001158035.1.16034 WP_001158035.1.1604 WP_001158035.1.16067 WP_001158035.1.16087 WP_001158035.1.16117 WP_001158035.1.16131 WP_001158035.1.16171 WP_001158035.1.16175 WP_001158035.1.16194 WP_001158035.1.1621 WP_001158035.1.1622 WP_001158035.1.16322 WP_001158035.1.16387 WP_001158035.1.16396 WP_001158035.1.1640 WP_001158035.1.16517 WP_001158035.1.16539 WP_001158035.1.16608 WP_001158035.1.16667 WP_001158035.1.16682 WP_001158035.1.16685 WP_001158035.1.16700 WP_001158035.1.16766 WP_001158035.1.16780 WP_001158035.1.16798 WP_001158035.1.16799 WP_001158035.1.16805 WP_001158035.1.16807 WP_001158035.1.16818 WP_001158035.1.16843 WP_001158035.1.16927 WP_001158035.1.16979 WP_001158035.1.17014 WP_001158035.1.17028 WP_001158035.1.17061 WP_001158035.1.1710 WP_001158035.1.17102 WP_001158035.1.17170 WP_001158035.1.17172 WP_001158035.1.17206 WP_001158035.1.17242 WP_001158035.1.17267 WP_001158035.1.17325 WP_001158035.1.17333 WP_001158035.1.17373 WP_001158035.1.17387 WP_001158035.1.17392 WP_001158035.1.17417 WP_001158035.1.17461 WP_001158035.1.17464 WP_001158035.1.17496 WP_001158035.1.17568 WP_001158035.1.17584 WP_001158035.1.17595 WP_001158035.1.17623 WP_001158035.1.17637 WP_001158035.1.1766 WP_001158035.1.1772 WP_001158035.1.17757 WP_001158035.1.17769 WP_001158035.1.17802 WP_001158035.1.17849 WP_001158035.1.17920 WP_001158035.1.17925 WP_001158035.1.17961 WP_001158035.1.17963 WP_001158035.1.17984 WP_001158035.1.1802 WP_001158035.1.18024 WP_001158035.1.18064 WP_001158035.1.18118 WP_001158035.1.18121 WP_001158035.1.18175 WP_001158035.1.1821 WP_001158035.1.18229 WP_001158035.1.18316 WP_001158035.1.18337 WP_001158035.1.18348 WP_001158035.1.18383 WP_001158035.1.18394 WP_001158035.1.18420 WP_001158035.1.18436 WP_001158035.1.18438 WP_001158035.1.1844 WP_001158035.1.18458 WP_001158035.1.18461 WP_001158035.1.18472 WP_001158035.1.18482 WP_001158035.1.18530 WP_001158035.1.18556 WP_001158035.1.18581 WP_001158035.1.1861 WP_001158035.1.18617 WP_001158035.1.1862 WP_001158035.1.18650 WP_001158035.1.18651 WP_001158035.1.18655 WP_001158035.1.18714 WP_001158035.1.18725 WP_001158035.1.18726 WP_001158035.1.1873 WP_001158035.1.18734 WP_001158035.1.18794 WP_001158035.1.188 WP_001158035.1.18801 WP_001158035.1.18802 WP_001158035.1.18828 WP_001158035.1.18843 WP_001158035.1.18861 WP_001158035.1.18876 WP_001158035.1.18899 WP_001158035.1.18908 WP_001158035.1.18923 WP_001158035.1.18934 WP_001158035.1.1896 WP_001158035.1.18962 WP_001158035.1.18966 WP_001158035.1.19036 WP_001158035.1.1909 WP_001158035.1.19090 WP_001158035.1.19135 WP_001158035.1.19146 WP_001158035.1.19147 WP_001158035.1.19153 WP_001158035.1.19171 WP_001158035.1.19245 WP_001158035.1.19276 WP_001158035.1.19297 WP_001158035.1.19332 WP_001158035.1.19374 WP_001158035.1.19379 WP_001158035.1.19389 WP_001158035.1.19397 WP_001158035.1.19424 WP_001158035.1.19465 WP_001158035.1.19494 WP_001158035.1.1952 WP_001158035.1.19534 WP_001158035.1.19547 WP_001158035.1.19581 WP_001158035.1.19583 WP_001158035.1.19593 WP_001158035.1.1960 WP_001158035.1.19649 WP_001158035.1.19654 WP_001158035.1.19761 WP_001158035.1.19778 WP_001158035.1.19830 WP_001158035.1.19861 WP_001158035.1.1987 WP_001158035.1.19972 WP_001158035.1.20114 WP_001158035.1.20115 WP_001158035.1.20133 WP_001158035.1.20159 WP_001158035.1.20224 WP_001158035.1.20238 WP_001158035.1.2027 WP_001158035.1.20289 WP_001158035.1.20318 WP_001158035.1.20334 WP_001158035.1.20388 WP_001158035.1.20452 WP_001158035.1.20493 WP_001158035.1.20519 WP_001158035.1.20549 WP_001158035.1.20565 WP_001158035.1.20575 WP_001158035.1.20640 WP_001158035.1.20662 WP_001158035.1.20709 WP_001158035.1.20724 WP_001158035.1.20741 WP_001158035.1.2075 WP_001158035.1.20761 WP_001158035.1.20784 WP_001158035.1.20803 WP_001158035.1.20818 WP_001158035.1.20841 WP_001158035.1.20863 WP_001158035.1.2089 WP_001158035.1.20933 WP_001158035.1.20962 WP_001158035.1.21041 WP_001158035.1.21104 WP_001158035.1.21137 WP_001158035.1.21152 WP_001158035.1.21236 WP_001158035.1.21255 WP_001158035.1.21266 WP_001158035.1.21336 WP_001158035.1.21378 WP_001158035.1.21441 WP_001158035.1.21450 WP_001158035.1.21455 WP_001158035.1.21519 WP_001158035.1.21526 WP_001158035.1.21537 WP_001158035.1.21614 WP_001158035.1.21628 WP_001158035.1.21634 WP_001158035.1.21652 WP_001158035.1.21667 WP_001158035.1.21714 WP_001158035.1.21729 WP_001158035.1.21732 WP_001158035.1.21773 WP_001158035.1.21812 WP_001158035.1.21899 WP_001158035.1.21945 WP_001158035.1.21948 WP_001158035.1.2198 WP_001158035.1.21986 WP_001158035.1.22021 WP_001158035.1.22042 WP_001158035.1.22088 WP_001158035.1.22161 WP_001158035.1.22189 WP_001158035.1.22203 WP_001158035.1.22204 WP_001158035.1.22269 WP_001158035.1.22272 WP_001158035.1.22280 WP_001158035.1.22291 WP_001158035.1.22293 WP_001158035.1.2242 WP_001158035.1.22431 WP_001158035.1.2245 WP_001158035.1.22464 WP_001158035.1.22494 WP_001158035.1.22508 WP_001158035.1.22543 WP_001158035.1.22544 WP_001158035.1.22549 WP_001158035.1.22576 WP_001158035.1.22602 WP_001158035.1.22667 WP_001158035.1.22685 WP_001158035.1.22691 WP_001158035.1.22757 WP_001158035.1.22777 WP_001158035.1.22814 WP_001158035.1.22824 WP_001158035.1.22868 WP_001158035.1.22908 WP_001158035.1.22917 WP_001158035.1.22939 WP_001158035.1.22988 WP_001158035.1.22993 WP_001158035.1.23005 WP_001158035.1.23021 WP_001158035.1.23078 WP_001158035.1.23109 WP_001158035.1.23135 WP_001158035.1.2322 WP_001158035.1.23230 WP_001158035.1.23282 WP_001158035.1.23290 WP_001158035.1.23330 WP_001158035.1.23351 WP_001158035.1.23383 WP_001158035.1.23386 WP_001158035.1.23388 WP_001158035.1.23393 WP_001158035.1.23435 WP_001158035.1.23463 WP_001158035.1.23487 WP_001158035.1.23520 WP_001158035.1.23522 WP_001158035.1.23527 WP_001158035.1.23575 WP_001158035.1.23593 WP_001158035.1.23625 WP_001158035.1.23686 WP_001158035.1.23693 WP_001158035.1.23700 WP_001158035.1.23711 WP_001158035.1.23724 WP_001158035.1.23741 WP_001158035.1.23752 WP_001158035.1.23754 WP_001158035.1.23804 WP_001158035.1.23840 WP_001158035.1.23869 WP_001158035.1.23890 WP_001158035.1.23950 WP_001158035.1.23953 WP_001158035.1.23960 WP_001158035.1.23962 WP_001158035.1.23985 WP_001158035.1.24004 WP_001158035.1.24024 WP_001158035.1.24038 WP_001158035.1.24045 WP_001158035.1.24088 WP_001158035.1.24127 WP_001158035.1.2413 WP_001158035.1.24136 WP_001158035.1.24169 WP_001158035.1.24177 WP_001158035.1.24278 WP_001158035.1.24381 WP_001158035.1.24383 WP_001158035.1.24458 WP_001158035.1.24460 WP_001158035.1.2449 WP_001158035.1.24523 WP_001158035.1.24524 WP_001158035.1.24536 WP_001158035.1.24575 WP_001158035.1.24577 WP_001158035.1.24592 WP_001158035.1.24641 WP_001158035.1.24642 WP_001158035.1.24646 WP_001158035.1.24650 WP_001158035.1.2469 WP_001158035.1.24703 WP_001158035.1.24752 WP_001158035.1.24758 WP_001158035.1.24763 WP_001158035.1.24773 WP_001158035.1.2479 WP_001158035.1.24797 WP_001158035.1.24808 WP_001158035.1.24906 WP_001158035.1.24909 WP_001158035.1.24926 WP_001158035.1.24939 WP_001158035.1.24979 WP_001158035.1.24984 WP_001158035.1.25019 WP_001158035.1.2502 WP_001158035.1.25021 WP_001158035.1.25079 WP_001158035.1.25086 WP_001158035.1.25087 WP_001158035.1.2512 WP_001158035.1.25174 WP_001158035.1.25193 WP_001158035.1.25204 WP_001158035.1.25248 WP_001158035.1.25270 WP_001158035.1.25272 WP_001158035.1.25372 WP_001158035.1.25378 WP_001158035.1.25380 WP_001158035.1.2540 WP_001158035.1.25414 WP_001158035.1.25420 WP_001158035.1.25446 WP_001158035.1.25480 WP_001158035.1.25548 WP_001158035.1.2558 WP_001158035.1.25592 WP_001158035.1.25612 WP_001158035.1.25613 WP_001158035.1.2567 WP_001158035.1.25680 WP_001158035.1.25681 WP_001158035.1.25701 WP_001158035.1.25712 WP_001158035.1.25724 WP_001158035.1.25726 WP_001158035.1.25869 WP_001158035.1.25873 WP_001158035.1.2588 WP_001158035.1.25886 WP_001158035.1.25890 WP_001158035.1.25895 WP_001158035.1.25945 WP_001158035.1.2597 WP_001158035.1.26040 WP_001158035.1.26055 WP_001158035.1.2606 WP_001158035.1.26061 WP_001158035.1.26076 WP_001158035.1.26092 WP_001158035.1.26131 WP_001158035.1.26161 WP_001158035.1.26175 WP_001158035.1.26186 WP_001158035.1.26189 WP_001158035.1.26196 WP_001158035.1.26259 WP_001158035.1.26262 WP_001158035.1.26270 WP_001158035.1.26284 WP_001158035.1.26304 WP_001158035.1.26325 WP_001158035.1.26398 WP_001158035.1.26419 WP_001158035.1.2642 WP_001158035.1.26479 WP_001158035.1.26574 WP_001158035.1.26579 WP_001158035.1.26598 WP_001158035.1.26613 WP_001158035.1.26627 WP_001158035.1.2665 WP_001158035.1.26659 WP_001158035.1.26660 WP_001158035.1.26683 WP_001158035.1.26688 WP_001158035.1.26720 WP_001158035.1.26782 WP_001158035.1.26837 WP_001158035.1.26839 WP_001158035.1.26861 WP_001158035.1.2688 WP_001158035.1.26932 WP_001158035.1.26941 WP_001158035.1.2695 WP_001158035.1.26950 WP_001158035.1.26987 WP_001158035.1.26995 WP_001158035.1.2700 WP_001158035.1.27019 WP_001158035.1.27043 WP_001158035.1.27060 WP_001158035.1.27091 WP_001158035.1.27141 WP_001158035.1.27148 WP_001158035.1.27188 WP_001158035.1.27234 WP_001158035.1.2731 WP_001158035.1.27310 WP_001158035.1.27313 WP_001158035.1.27330 WP_001158035.1.27396 WP_001158035.1.27401 WP_001158035.1.27424 WP_001158035.1.2745 WP_001158035.1.27520 WP_001158035.1.27524 WP_001158035.1.27580 WP_001158035.1.27585 WP_001158035.1.27618 WP_001158035.1.27693 WP_001158035.1.27723 WP_001158035.1.27758 WP_001158035.1.2779 WP_001158035.1.27797 WP_001158035.1.2782 WP_001158035.1.27846 WP_001158035.1.27856 WP_001158035.1.27861 WP_001158035.1.27871 WP_001158035.1.27876 WP_001158035.1.27897 WP_001158035.1.27913 WP_001158035.1.27932 WP_001158035.1.2794 WP_001158035.1.27998 WP_001158035.1.28008 WP_001158035.1.28026 WP_001158035.1.28027 WP_001158035.1.28051 WP_001158035.1.28102 WP_001158035.1.28109 WP_001158035.1.28110 WP_001158035.1.28145 WP_001158035.1.28156 WP_001158035.1.28167 WP_001158035.1.28184 WP_001158035.1.28199 WP_001158035.1.28314 WP_001158035.1.28322 WP_001158035.1.28345 WP_001158035.1.28349 WP_001158035.1.2838 WP_001158035.1.28401 WP_001158035.1.28461 WP_001158035.1.28476 WP_001158035.1.28480 WP_001158035.1.285 WP_001158035.1.28500 WP_001158035.1.28523 WP_001158035.1.28568 WP_001158035.1.28639 WP_001158035.1.2866 WP_001158035.1.28683 WP_001158035.1.28723 WP_001158035.1.28732 WP_001158035.1.28736 WP_001158035.1.28742 WP_001158035.1.2881 WP_001158035.1.28829 WP_001158035.1.28842 WP_001158035.1.28924 WP_001158035.1.28982 WP_001158035.1.29049 WP_001158035.1.29082 WP_001158035.1.29125 WP_001158035.1.29150 WP_001158035.1.29164 WP_001158035.1.29258 WP_001158035.1.29341 WP_001158035.1.29377 WP_001158035.1.29394 WP_001158035.1.29443 WP_001158035.1.29486 WP_001158035.1.29497 WP_001158035.1.29503 WP_001158035.1.29504 WP_001158035.1.29513 WP_001158035.1.2952 WP_001158035.1.29523 WP_001158035.1.2954 WP_001158035.1.29590 WP_001158035.1.29603 WP_001158035.1.2963 WP_001158035.1.29647 WP_001158035.1.29662 WP_001158035.1.29669 WP_001158035.1.29715 WP_001158035.1.29798 WP_001158035.1.29812 WP_001158035.1.29815 WP_001158035.1.29819 WP_001158035.1.29820 WP_001158035.1.29821 WP_001158035.1.29840 WP_001158035.1.29855 WP_001158035.1.29874 WP_001158035.1.29876 WP_001158035.1.29884 WP_001158035.1.29979 WP_001158035.1.29988 WP_001158035.1.30035 WP_001158035.1.30063 WP_001158035.1.30098 WP_001158035.1.30105 WP_001158035.1.3018 WP_001158035.1.30232 WP_001158035.1.30239 WP_001158035.1.30269 WP_001158035.1.30298 WP_001158035.1.30397 WP_001158035.1.30400 WP_001158035.1.30428 WP_001158035.1.30447 WP_001158035.1.30524 WP_001158035.1.30536 WP_001158035.1.3055 WP_001158035.1.30550 WP_001158035.1.30570 WP_001158035.1.306 WP_001158035.1.30658 WP_001158035.1.30665 WP_001158035.1.30691 WP_001158035.1.30762 WP_001158035.1.30808 WP_001158035.1.3083 WP_001158035.1.30853 WP_001158035.1.30867 WP_001158035.1.30879 WP_001158035.1.30887 WP_001158035.1.30896 WP_001158035.1.309 WP_001158035.1.30905 WP_001158035.1.30906 WP_001158035.1.30987 WP_001158035.1.31009 WP_001158035.1.31017 WP_001158035.1.31029 WP_001158035.1.31083 WP_001158035.1.31119 WP_001158035.1.31129 WP_001158035.1.31149 WP_001158035.1.31188 WP_001158035.1.31295 WP_001158035.1.31319 WP_001158035.1.31340 WP_001158035.1.31347 WP_001158035.1.31357 WP_001158035.1.31419 WP_001158035.1.31422 WP_001158035.1.31429 WP_001158035.1.31433 WP_001158035.1.3147 WP_001158035.1.31511 WP_001158035.1.31518 WP_001158035.1.31521 WP_001158035.1.31542 WP_001158035.1.31557 WP_001158035.1.31559 WP_001158035.1.31596 WP_001158035.1.31657 WP_001158035.1.31675 WP_001158035.1.31803 WP_001158035.1.31809 WP_001158035.1.31823 WP_001158035.1.31825 WP_001158035.1.31835 WP_001158035.1.31860 WP_001158035.1.31863 WP_001158035.1.31866 WP_001158035.1.31924 WP_001158035.1.3193 WP_001158035.1.3201 WP_001158035.1.32021 WP_001158035.1.32024 WP_001158035.1.3203 WP_001158035.1.32030 WP_001158035.1.32091 WP_001158035.1.32138 WP_001158035.1.32142 WP_001158035.1.32184 WP_001158035.1.32225 WP_001158035.1.32236 WP_001158035.1.32287 WP_001158035.1.32406 WP_001158035.1.32432 WP_001158035.1.32443 WP_001158035.1.3247 WP_001158035.1.32475 WP_001158035.1.32478 WP_001158035.1.3248 WP_001158035.1.32480 WP_001158035.1.32494 WP_001158035.1.32518 WP_001158035.1.32558 WP_001158035.1.32587 WP_001158035.1.3259 WP_001158035.1.32650 WP_001158035.1.32676 WP_001158035.1.3269 WP_001158035.1.32709 WP_001158035.1.32718 WP_001158035.1.32748 WP_001158035.1.32772 WP_001158035.1.32831 WP_001158035.1.32875 WP_001158035.1.32938 WP_001158035.1.32995 WP_001158035.1.33026 WP_001158035.1.33046 WP_001158035.1.33101 WP_001158035.1.33179 WP_001158035.1.33190 WP_001158035.1.33217 WP_001158035.1.33222 WP_001158035.1.33303 WP_001158035.1.33341 WP_001158035.1.33352 WP_001158035.1.33369 WP_001158035.1.33410 WP_001158035.1.33428 WP_001158035.1.3344 WP_001158035.1.33475 WP_001158035.1.33525 WP_001158035.1.3354 WP_001158035.1.33563 WP_001158035.1.33584 WP_001158035.1.33595 WP_001158035.1.33680 WP_001158035.1.33823 WP_001158035.1.33896 WP_001158035.1.33914 WP_001158035.1.34094 WP_001158035.1.34117 WP_001158035.1.34121 WP_001158035.1.34122 WP_001158035.1.34130 WP_001158035.1.34144 WP_001158035.1.34206 WP_001158035.1.34208 WP_001158035.1.34294 WP_001158035.1.34303 WP_001158035.1.3432 WP_001158035.1.34348 WP_001158035.1.34362 WP_001158035.1.34400 WP_001158035.1.34422 WP_001158035.1.3444 WP_001158035.1.34441 WP_001158035.1.34444 WP_001158035.1.34456 WP_001158035.1.34470 WP_001158035.1.34528 WP_001158035.1.34558 WP_001158035.1.3460 WP_001158035.1.34617 WP_001158035.1.34675 WP_001158035.1.34683 WP_001158035.1.3469 WP_001158035.1.3472 WP_001158035.1.34763 WP_001158035.1.34835 WP_001158035.1.34838 WP_001158035.1.34855 WP_001158035.1.34875 WP_001158035.1.34887 WP_001158035.1.34913 WP_001158035.1.34931 WP_001158035.1.34966 WP_001158035.1.35003 WP_001158035.1.35006 WP_001158035.1.35007 WP_001158035.1.35012 WP_001158035.1.35107 WP_001158035.1.35114 WP_001158035.1.35127 WP_001158035.1.35132 WP_001158035.1.35168 WP_001158035.1.35198 WP_001158035.1.35208 WP_001158035.1.35220 WP_001158035.1.35253 WP_001158035.1.35258 WP_001158035.1.35316 WP_001158035.1.35328 WP_001158035.1.3539 WP_001158035.1.35394 WP_001158035.1.35448 WP_001158035.1.35464 WP_001158035.1.35465 WP_001158035.1.35468 WP_001158035.1.35483 WP_001158035.1.35578 WP_001158035.1.35627 WP_001158035.1.35632 WP_001158035.1.35651 WP_001158035.1.35653 WP_001158035.1.35741 WP_001158035.1.35744 WP_001158035.1.35789 WP_001158035.1.35889 WP_001158035.1.35922 WP_001158035.1.35927 WP_001158035.1.35934 WP_001158035.1.35942 WP_001158035.1.35959 WP_001158035.1.35963 WP_001158035.1.35987 WP_001158035.1.35990 WP_001158035.1.3600 WP_001158035.1.36042 WP_001158035.1.36070 WP_001158035.1.36085 WP_001158035.1.36094 WP_001158035.1.36105 WP_001158035.1.36132 WP_001158035.1.36158 WP_001158035.1.36166 WP_001158035.1.36177 WP_001158035.1.3624 WP_001158035.1.36332 WP_001158035.1.36352 WP_001158035.1.36405 WP_001158035.1.36414 WP_001158035.1.3643 WP_001158035.1.36459 WP_001158035.1.365 WP_001158035.1.36500 WP_001158035.1.36507 WP_001158035.1.36545 WP_001158035.1.36628 WP_001158035.1.36667 WP_001158035.1.3668 WP_001158035.1.36699 WP_001158035.1.36707 WP_001158035.1.3671 WP_001158035.1.36724 WP_001158035.1.36761 WP_001158035.1.36799 WP_001158035.1.36812 WP_001158035.1.36856 WP_001158035.1.36886 WP_001158035.1.36904 WP_001158035.1.36925 WP_001158035.1.3697 WP_001158035.1.36975 WP_001158035.1.37032 WP_001158035.1.37046 WP_001158035.1.37049 WP_001158035.1.37099 WP_001158035.1.37103 WP_001158035.1.37153 WP_001158035.1.37206 WP_001158035.1.37226 WP_001158035.1.37266 WP_001158035.1.37290 WP_001158035.1.37306 WP_001158035.1.37312 WP_001158035.1.37313 WP_001158035.1.37342 WP_001158035.1.37352 WP_001158035.1.37360 WP_001158035.1.37371 WP_001158035.1.37388 WP_001158035.1.37423 WP_001158035.1.37477 WP_001158035.1.37510 WP_001158035.1.37516 WP_001158035.1.37538 WP_001158035.1.37544 WP_001158035.1.37550 WP_001158035.1.37592 WP_001158035.1.37608 WP_001158035.1.37664 WP_001158035.1.377 WP_001158035.1.3772 WP_001158035.1.37736 WP_001158035.1.37758 WP_001158035.1.37773 WP_001158035.1.37817 WP_001158035.1.37852 WP_001158035.1.37853 WP_001158035.1.37880 WP_001158035.1.37887 WP_001158035.1.37917 WP_001158035.1.37923 WP_001158035.1.3796 WP_001158035.1.37962 WP_001158035.1.37984 WP_001158035.1.37995 WP_001158035.1.37998 WP_001158035.1.38000 WP_001158035.1.38033 WP_001158035.1.38043 WP_001158035.1.38081 WP_001158035.1.38103 WP_001158035.1.38120 WP_001158035.1.38162 WP_001158035.1.38185 WP_001158035.1.38194 WP_001158035.1.38234 WP_001158035.1.38257 WP_001158035.1.38293 WP_001158035.1.38300 WP_001158035.1.38412 WP_001158035.1.38561 WP_001158035.1.38567 WP_001158035.1.38626 WP_001158035.1.38629 WP_001158035.1.38722 WP_001158035.1.3873 WP_001158035.1.38777 WP_001158035.1.38782 WP_001158035.1.38811 WP_001158035.1.38911 WP_001158035.1.38937 WP_001158035.1.39005 WP_001158035.1.39037 WP_001158035.1.39103 WP_001158035.1.3912 WP_001158035.1.39123 WP_001158035.1.39148 WP_001158035.1.39184 WP_001158035.1.39196 WP_001158035.1.39209 WP_001158035.1.3922 WP_001158035.1.39232 WP_001158035.1.39254 WP_001158035.1.39289 WP_001158035.1.39302 WP_001158035.1.39305 WP_001158035.1.39313 WP_001158035.1.39325 WP_001158035.1.39327 WP_001158035.1.39335 WP_001158035.1.39377 WP_001158035.1.39401 WP_001158035.1.39402 WP_001158035.1.39423 WP_001158035.1.39492 WP_001158035.1.39509 WP_001158035.1.39531 WP_001158035.1.3954 WP_001158035.1.39575 WP_001158035.1.39610 WP_001158035.1.39651 WP_001158035.1.39690 WP_001158035.1.3970 WP_001158035.1.39708 WP_001158035.1.39713 WP_001158035.1.39717 WP_001158035.1.39726 WP_001158035.1.39733 WP_001158035.1.39734 WP_001158035.1.39780 WP_001158035.1.39796 WP_001158035.1.39809 WP_001158035.1.39818 WP_001158035.1.39867 WP_001158035.1.39892 WP_001158035.1.39973 WP_001158035.1.40 WP_001158035.1.4005 WP_001158035.1.40083 WP_001158035.1.40107 WP_001158035.1.40140 WP_001158035.1.40147 WP_001158035.1.40153 WP_001158035.1.40190 WP_001158035.1.4020 WP_001158035.1.40206 WP_001158035.1.40211 WP_001158035.1.40249 WP_001158035.1.40300 WP_001158035.1.40335 WP_001158035.1.40345 WP_001158035.1.40349 WP_001158035.1.40360 WP_001158035.1.40382 WP_001158035.1.40403 WP_001158035.1.40486 WP_001158035.1.4049 WP_001158035.1.40539 WP_001158035.1.40560 WP_001158035.1.40563 WP_001158035.1.40599 WP_001158035.1.40607 WP_001158035.1.40636 WP_001158035.1.40657 WP_001158035.1.40660 WP_001158035.1.40686 WP_001158035.1.40715 WP_001158035.1.40781 WP_001158035.1.40813 WP_001158035.1.40842 WP_001158035.1.40843 WP_001158035.1.40865 WP_001158035.1.40893 WP_001158035.1.41041 WP_001158035.1.41063 WP_001158035.1.41078 WP_001158035.1.41113 WP_001158035.1.41125 WP_001158035.1.41147 WP_001158035.1.4122 WP_001158035.1.41239 WP_001158035.1.41263 WP_001158035.1.41287 WP_001158035.1.41315 WP_001158035.1.41332 WP_001158035.1.41368 WP_001158035.1.41371 WP_001158035.1.41392 WP_001158035.1.41394 WP_001158035.1.41402 WP_001158035.1.41407 WP_001158035.1.4142 WP_001158035.1.41453 WP_001158035.1.41455 WP_001158035.1.41466 WP_001158035.1.41481 WP_001158035.1.41482 WP_001158035.1.41483 WP_001158035.1.41545 WP_001158035.1.4158 WP_001158035.1.41613 WP_001158035.1.41712 WP_001158035.1.4172 WP_001158035.1.41741 WP_001158035.1.41752 WP_001158035.1.41780 WP_001158035.1.41783 WP_001158035.1.41809 WP_001158035.1.41837 WP_001158035.1.41847 WP_001158035.1.41884 WP_001158035.1.41885 WP_001158035.1.4189 WP_001158035.1.41923 WP_001158035.1.4193 WP_001158035.1.41956 WP_001158035.1.41990 WP_001158035.1.41991 WP_001158035.1.42027 WP_001158035.1.42038 WP_001158035.1.42044 WP_001158035.1.42060 WP_001158035.1.42138 WP_001158035.1.4214 WP_001158035.1.42151 WP_001158035.1.42191 WP_001158035.1.42203 WP_001158035.1.42221 WP_001158035.1.42228 WP_001158035.1.4224 WP_001158035.1.42252 WP_001158035.1.42258 WP_001158035.1.42350 WP_001158035.1.42387 WP_001158035.1.42413 WP_001158035.1.42415 WP_001158035.1.42442 WP_001158035.1.42443 WP_001158035.1.42480 WP_001158035.1.42516 WP_001158035.1.42586 WP_001158035.1.42597 WP_001158035.1.42600 WP_001158035.1.42601 WP_001158035.1.42638 WP_001158035.1.42670 WP_001158035.1.42677 WP_001158035.1.42709 WP_001158035.1.42748 WP_001158035.1.42749 WP_001158035.1.42804 WP_001158035.1.42808 WP_001158035.1.42832 WP_001158035.1.42891 WP_001158035.1.42903 WP_001158035.1.42962 WP_001158035.1.42970 WP_001158035.1.42991 WP_001158035.1.43027 WP_001158035.1.43123 WP_001158035.1.43132 WP_001158035.1.43137 WP_001158035.1.43166 WP_001158035.1.43170 WP_001158035.1.43177 WP_001158035.1.43213 WP_001158035.1.43216 WP_001158035.1.43239 WP_001158035.1.43278 WP_001158035.1.43316 WP_001158035.1.4334 WP_001158035.1.43363 WP_001158035.1.4342 WP_001158035.1.43422 WP_001158035.1.43427 WP_001158035.1.4343 WP_001158035.1.43455 WP_001158035.1.43474 WP_001158035.1.43501 WP_001158035.1.4356 WP_001158035.1.436 WP_001158035.1.43642 WP_001158035.1.43720 WP_001158035.1.43733 WP_001158035.1.43738 WP_001158035.1.43750 WP_001158035.1.43803 WP_001158035.1.43868 WP_001158035.1.43918 WP_001158035.1.43942 WP_001158035.1.43953 WP_001158035.1.43966 WP_001158035.1.440 WP_001158035.1.44018 WP_001158035.1.44029 WP_001158035.1.44051 WP_001158035.1.44077 WP_001158035.1.4415 WP_001158035.1.44201 WP_001158035.1.44238 WP_001158035.1.44251 WP_001158035.1.44263 WP_001158035.1.44273 WP_001158035.1.44285 WP_001158035.1.44327 WP_001158035.1.44354 WP_001158035.1.44394 WP_001158035.1.44422 WP_001158035.1.44445 WP_001158035.1.44447 WP_001158035.1.44460 WP_001158035.1.44461 WP_001158035.1.4449 WP_001158035.1.44524 WP_001158035.1.4454 WP_001158035.1.4459 WP_001158035.1.44622 WP_001158035.1.4463 WP_001158035.1.44642 WP_001158035.1.44649 WP_001158035.1.44668 WP_001158035.1.4471 WP_001158035.1.44717 WP_001158035.1.44759 WP_001158035.1.44784 WP_001158035.1.44836 WP_001158035.1.44855 WP_001158035.1.44857 WP_001158035.1.44961 WP_001158035.1.44975 WP_001158035.1.45190 WP_001158035.1.4530 WP_001158035.1.4538 WP_001158035.1.45405 WP_001158035.1.4541 WP_001158035.1.45444 WP_001158035.1.45486 WP_001158035.1.45525 WP_001158035.1.45536 WP_001158035.1.45600 WP_001158035.1.45627 WP_001158035.1.45674 WP_001158035.1.45676 WP_001158035.1.45740 WP_001158035.1.4576 WP_001158035.1.45789 WP_001158035.1.45793 WP_001158035.1.45801 WP_001158035.1.45806 WP_001158035.1.4583 WP_001158035.1.45840 WP_001158035.1.45865 WP_001158035.1.45868 WP_001158035.1.45921 WP_001158035.1.45930 WP_001158035.1.45960 WP_001158035.1.45968 WP_001158035.1.45990 WP_001158035.1.46016 WP_001158035.1.46027 WP_001158035.1.46048 WP_001158035.1.46049 WP_001158035.1.46070 WP_001158035.1.46081 WP_001158035.1.4610 WP_001158035.1.46105 WP_001158035.1.46122 WP_001158035.1.4613 WP_001158035.1.46164 WP_001158035.1.46197 WP_001158035.1.46239 WP_001158035.1.46257 WP_001158035.1.46263 WP_001158035.1.46291 WP_001158035.1.46301 WP_001158035.1.46378 WP_001158035.1.46379 WP_001158035.1.46433 WP_001158035.1.46438 WP_001158035.1.4646 WP_001158035.1.46477 WP_001158035.1.46526 WP_001158035.1.46531 WP_001158035.1.46555 WP_001158035.1.4657 WP_001158035.1.46589 WP_001158035.1.46594 WP_001158035.1.46614 WP_001158035.1.46616 WP_001158035.1.46643 WP_001158035.1.46668 WP_001158035.1.46743 WP_001158035.1.46795 WP_001158035.1.46806 WP_001158035.1.46833 WP_001158035.1.46841 WP_001158035.1.46860 WP_001158035.1.4695 WP_001158035.1.46991 WP_001158035.1.46994 WP_001158035.1.46999 WP_001158035.1.47024 WP_001158035.1.47028 WP_001158035.1.47034 WP_001158035.1.47039 WP_001158035.1.47047 WP_001158035.1.47050 WP_001158035.1.47054 WP_001158035.1.47069 WP_001158035.1.47073 WP_001158035.1.47124 WP_001158035.1.47167 WP_001158035.1.47189 WP_001158035.1.47235 WP_001158035.1.47246 WP_001158035.1.47247 WP_001158035.1.4725 WP_001158035.1.47280 WP_001158035.1.47332 WP_001158035.1.47344 WP_001158035.1.47349 WP_001158035.1.47363 WP_001158035.1.47366 WP_001158035.1.47398 WP_001158035.1.4743 WP_001158035.1.47454 WP_001158035.1.47464 WP_001158035.1.47473 WP_001158035.1.47498 WP_001158035.1.47500 WP_001158035.1.47533 WP_001158035.1.47546 WP_001158035.1.47555 WP_001158035.1.47599 WP_001158035.1.47662 WP_001158035.1.47709 WP_001158035.1.47722 WP_001158035.1.47790 WP_001158035.1.47820 WP_001158035.1.4783 WP_001158035.1.47935 WP_001158035.1.4796 WP_001158035.1.47976 WP_001158035.1.48000 WP_001158035.1.48018 WP_001158035.1.48029 WP_001158035.1.48040 WP_001158035.1.48051 WP_001158035.1.48077 WP_001158035.1.48090 WP_001158035.1.4811 WP_001158035.1.48121 WP_001158035.1.48144 WP_001158035.1.48168 WP_001158035.1.48216 WP_001158035.1.48222 WP_001158035.1.48229 WP_001158035.1.4826 WP_001158035.1.48265 WP_001158035.1.48317 WP_001158035.1.48421 WP_001158035.1.48431 WP_001158035.1.48433 WP_001158035.1.48469 WP_001158035.1.4857 WP_001158035.1.48571 WP_001158035.1.48615 WP_001158035.1.48620 WP_001158035.1.48626 WP_001158035.1.48629 WP_001158035.1.48689 WP_001158035.1.4876 WP_001158035.1.48801 WP_001158035.1.48808 WP_001158035.1.48827 WP_001158035.1.48921 WP_001158035.1.48954 WP_001158035.1.49001 WP_001158035.1.49061 WP_001158035.1.49107 WP_001158035.1.49124 WP_001158035.1.49147 WP_001158035.1.49170 WP_001158035.1.49179 WP_001158035.1.49190 WP_001158035.1.49229 WP_001158035.1.49243 WP_001158035.1.49258 WP_001158035.1.49321 WP_001158035.1.49336 WP_001158035.1.49338 WP_001158035.1.49347 WP_001158035.1.49446 WP_001158035.1.49459 WP_001158035.1.49481 WP_001158035.1.49483 WP_001158035.1.4949 WP_001158035.1.49521 WP_001158035.1.49522 WP_001158035.1.49546 WP_001158035.1.49558 WP_001158035.1.49594 WP_001158035.1.49615 WP_001158035.1.49621 WP_001158035.1.49625 WP_001158035.1.49662 WP_001158035.1.49675 WP_001158035.1.49712 WP_001158035.1.49774 WP_001158035.1.49783 WP_001158035.1.49788 WP_001158035.1.49794 WP_001158035.1.49820 WP_001158035.1.4985 WP_001158035.1.49856 WP_001158035.1.49861 WP_001158035.1.49884 WP_001158035.1.49941 WP_001158035.1.49950 WP_001158035.1.49954 WP_001158035.1.49972 WP_001158035.1.49987 WP_001158035.1.50036 WP_001158035.1.50056 WP_001158035.1.50058 WP_001158035.1.50113 WP_001158035.1.50119 WP_001158035.1.50146 WP_001158035.1.50179 WP_001158035.1.50182 WP_001158035.1.50187 WP_001158035.1.50191 WP_001158035.1.50207 WP_001158035.1.50214 WP_001158035.1.50228 WP_001158035.1.50258 WP_001158035.1.50262 WP_001158035.1.50269 WP_001158035.1.50270 WP_001158035.1.50361 WP_001158035.1.50418 WP_001158035.1.50427 WP_001158035.1.50585 WP_001158035.1.50608 WP_001158035.1.50616 WP_001158035.1.50627 WP_001158035.1.5064 WP_001158035.1.50690 WP_001158035.1.50700 WP_001158035.1.50725 WP_001158035.1.50728 WP_001158035.1.50887 WP_001158035.1.50925 WP_001158035.1.50939 WP_001158035.1.50947 WP_001158035.1.50969 WP_001158035.1.50988 WP_001158035.1.50990 WP_001158035.1.50996 WP_001158035.1.51013 WP_001158035.1.511 WP_001158035.1.51109 WP_001158035.1.51170 WP_001158035.1.51175 WP_001158035.1.51180 WP_001158035.1.51190 WP_001158035.1.51203 WP_001158035.1.51211 WP_001158035.1.5124 WP_001158035.1.51248 WP_001158035.1.51253 WP_001158035.1.51260 WP_001158035.1.51278 WP_001158035.1.51283 WP_001158035.1.51299 WP_001158035.1.51323 WP_001158035.1.51330 WP_001158035.1.51360 WP_001158035.1.51392 WP_001158035.1.51405 WP_001158035.1.51426 WP_001158035.1.51427 WP_001158035.1.51462 WP_001158035.1.51490 WP_001158035.1.51525 WP_001158035.1.51537 WP_001158035.1.5158 WP_001158035.1.51580 WP_001158035.1.51596 WP_001158035.1.51629 WP_001158035.1.51690 WP_001158035.1.51707 WP_001158035.1.51757 WP_001158035.1.518 WP_001158035.1.51804 WP_001158035.1.51839 WP_001158035.1.51881 WP_001158035.1.51896 WP_001158035.1.51944 WP_001158035.1.51949 WP_001158035.1.51979 WP_001158035.1.51985 WP_001158035.1.5199 WP_001158035.1.52048 WP_001158035.1.52085 WP_001158035.1.52098 WP_001158035.1.52137 WP_001158035.1.52171 WP_001158035.1.52213 WP_001158035.1.52257 WP_001158035.1.5227 WP_001158035.1.52270 WP_001158035.1.52271 WP_001158035.1.52272 WP_001158035.1.52299 WP_001158035.1.52313 WP_001158035.1.52363 WP_001158035.1.52378 WP_001158035.1.5239 WP_001158035.1.52568 WP_001158035.1.52662 WP_001158035.1.52691 WP_001158035.1.52710 WP_001158035.1.52735 WP_001158035.1.52771 WP_001158035.1.52777 WP_001158035.1.52781 WP_001158035.1.5285 WP_001158035.1.52855 WP_001158035.1.52881 WP_001158035.1.52913 WP_001158035.1.52962 WP_001158035.1.53021 WP_001158035.1.53027 WP_001158035.1.5310 WP_001158035.1.53123 WP_001158035.1.53162 WP_001158035.1.532 WP_001158035.1.53223 WP_001158035.1.53242 WP_001158035.1.53251 WP_001158035.1.53356 WP_001158035.1.53360 WP_001158035.1.53364 WP_001158035.1.53401 WP_001158035.1.53410 WP_001158035.1.53415 WP_001158035.1.5342 WP_001158035.1.53537 WP_001158035.1.53556 WP_001158035.1.53557 WP_001158035.1.53587 WP_001158035.1.53589 WP_001158035.1.5362 WP_001158035.1.53642 WP_001158035.1.53649 WP_001158035.1.53687 WP_001158035.1.53690 WP_001158035.1.53693 WP_001158035.1.53863 WP_001158035.1.53866 WP_001158035.1.5391 WP_001158035.1.53940 WP_001158035.1.53966 WP_001158035.1.53978 WP_001158035.1.53991 WP_001158035.1.54023 WP_001158035.1.54051 WP_001158035.1.54072 WP_001158035.1.54091 WP_001158035.1.54095 WP_001158035.1.54102 WP_001158035.1.54104 WP_001158035.1.54185 WP_001158035.1.54188 WP_001158035.1.54202 WP_001158035.1.54208 WP_001158035.1.54307 WP_001158035.1.54313 WP_001158035.1.54317 WP_001158035.1.54328 WP_001158035.1.5434 WP_001158035.1.54388 WP_001158035.1.54394 WP_001158035.1.54411 WP_001158035.1.54418 WP_001158035.1.54429 WP_001158035.1.54439 WP_001158035.1.54524 WP_001158035.1.54534 WP_001158035.1.54590 WP_001158035.1.54591 WP_001158035.1.54601 WP_001158035.1.54638 WP_001158035.1.54643 WP_001158035.1.54688 WP_001158035.1.54708 WP_001158035.1.54725 WP_001158035.1.54729 WP_001158035.1.54754 WP_001158035.1.54760 WP_001158035.1.5478 WP_001158035.1.54798 WP_001158035.1.54829 WP_001158035.1.54875 WP_001158035.1.54940 WP_001158035.1.54972 WP_001158035.1.54993 WP_001158035.1.55009 WP_001158035.1.55115 WP_001158035.1.55134 WP_001158035.1.55144 WP_001158035.1.55149 WP_001158035.1.55151 WP_001158035.1.55179 WP_001158035.1.55197 WP_001158035.1.5520 WP_001158035.1.55222 WP_001158035.1.55273 WP_001158035.1.55275 WP_001158035.1.55338 WP_001158035.1.55357 WP_001158035.1.55417 WP_001158035.1.55420 WP_001158035.1.5546 WP_001158035.1.55466 WP_001158035.1.55472 WP_001158035.1.55550 WP_001158035.1.55563 WP_001158035.1.55597 WP_001158035.1.5561 WP_001158035.1.5570 WP_001158035.1.55730 WP_001158035.1.55731 WP_001158035.1.55744 WP_001158035.1.55787 WP_001158035.1.55790 WP_001158035.1.55808 WP_001158035.1.55844 WP_001158035.1.55888 WP_001158035.1.55896 WP_001158035.1.55981 WP_001158035.1.55988 WP_001158035.1.55990 WP_001158035.1.56033 WP_001158035.1.56040 WP_001158035.1.56047 WP_001158035.1.56122 WP_001158035.1.56139 WP_001158035.1.56142 WP_001158035.1.56149 WP_001158035.1.56169 WP_001158035.1.56193 WP_001158035.1.562 WP_001158035.1.56216 WP_001158035.1.56231 WP_001158035.1.56278 WP_001158035.1.56293 WP_001158035.1.56302 WP_001158035.1.5632 WP_001158035.1.56338 WP_001158035.1.56371 WP_001158035.1.56390 WP_001158035.1.56399 WP_001158035.1.56402 WP_001158035.1.56439 WP_001158035.1.56457 WP_001158035.1.5646 WP_001158035.1.56469 WP_001158035.1.56502 WP_001158035.1.56523 WP_001158035.1.56543 WP_001158035.1.56650 WP_001158035.1.56662 WP_001158035.1.56680 WP_001158035.1.56689 WP_001158035.1.5670 WP_001158035.1.56704 WP_001158035.1.56714 WP_001158035.1.56721 WP_001158035.1.56821 WP_001158035.1.56835 WP_001158035.1.56933 WP_001158035.1.56936 WP_001158035.1.56941 WP_001158035.1.57011 WP_001158035.1.57045 WP_001158035.1.57072 WP_001158035.1.57079 WP_001158035.1.57086 WP_001158035.1.57182 WP_001158035.1.57213 WP_001158035.1.57222 WP_001158035.1.57266 WP_001158035.1.57278 WP_001158035.1.57281 WP_001158035.1.57438 WP_001158035.1.57451 WP_001158035.1.5748 WP_001158035.1.57492 WP_001158035.1.57538 WP_001158035.1.57539 WP_001158035.1.5755 WP_001158035.1.57550 WP_001158035.1.57608 WP_001158035.1.57629 WP_001158035.1.57638 WP_001158035.1.57812 WP_001158035.1.57832 WP_001158035.1.57854 WP_001158035.1.5787 WP_001158035.1.57920 WP_001158035.1.57982 WP_001158035.1.57983 WP_001158035.1.57994 WP_001158035.1.58001 WP_001158035.1.58009 WP_001158035.1.58022 WP_001158035.1.58092 WP_001158035.1.58094 WP_001158035.1.58097 WP_001158035.1.58098 WP_001158035.1.5810 WP_001158035.1.58107 WP_001158035.1.58163 WP_001158035.1.58172 WP_001158035.1.58226 WP_001158035.1.58233 WP_001158035.1.58244 WP_001158035.1.58248 WP_001158035.1.58267 WP_001158035.1.58289 WP_001158035.1.58292 WP_001158035.1.58336 WP_001158035.1.58345 WP_001158035.1.58371 WP_001158035.1.58414 WP_001158035.1.58424 WP_001158035.1.58444 WP_001158035.1.58449 WP_001158035.1.58459 WP_001158035.1.585 WP_001158035.1.58507 WP_001158035.1.58547 WP_001158035.1.58552 WP_001158035.1.58560 WP_001158035.1.58572 WP_001158035.1.58609 WP_001158035.1.58617 WP_001158035.1.58657 WP_001158035.1.58692 WP_001158035.1.58705 WP_001158035.1.58737 WP_001158035.1.58799 WP_001158035.1.58870 WP_001158035.1.58977 WP_001158035.1.58983 WP_001158035.1.58999 WP_001158035.1.5906 WP_001158035.1.59060 WP_001158035.1.59073 WP_001158035.1.59119 WP_001158035.1.59174 WP_001158035.1.59190 WP_001158035.1.59199 WP_001158035.1.59263 WP_001158035.1.5927 WP_001158035.1.59291 WP_001158035.1.59292 WP_001158035.1.59293 WP_001158035.1.59413 WP_001158035.1.5942 WP_001158035.1.59425 WP_001158035.1.59426 WP_001158035.1.59483 WP_001158035.1.59572 WP_001158035.1.59577 WP_001158035.1.59579 WP_001158035.1.59611 WP_001158035.1.59613 WP_001158035.1.59621 WP_001158035.1.5963 WP_001158035.1.59660 WP_001158035.1.59699 WP_001158035.1.59714 WP_001158035.1.59717 WP_001158035.1.59737 WP_001158035.1.59745 WP_001158035.1.59748 WP_001158035.1.59782 WP_001158035.1.59788 WP_001158035.1.59793 WP_001158035.1.59815 WP_001158035.1.59853 WP_001158035.1.59894 WP_001158035.1.59900 WP_001158035.1.59970 WP_001158035.1.59980 WP_001158035.1.59981 WP_001158035.1.60048 WP_001158035.1.60070 WP_001158035.1.60095 WP_001158035.1.60096 WP_001158035.1.60110 WP_001158035.1.60133 WP_001158035.1.6022 WP_001158035.1.60225 WP_001158035.1.60235 WP_001158035.1.60325 WP_001158035.1.60337 WP_001158035.1.60350 WP_001158035.1.60373 WP_001158035.1.60387 WP_001158035.1.60411 WP_001158035.1.60436 WP_001158035.1.60491 WP_001158035.1.60544 WP_001158035.1.6059 WP_001158035.1.60591 WP_001158035.1.60606 WP_001158035.1.60630 WP_001158035.1.60654 WP_001158035.1.6068 WP_001158035.1.60698 WP_001158035.1.60732 WP_001158035.1.60835 WP_001158035.1.61006 WP_001158035.1.61058 WP_001158035.1.6110 WP_001158035.1.61112 WP_001158035.1.61121 WP_001158035.1.61132 WP_001158035.1.61174 WP_001158035.1.61175 WP_001158035.1.61245 WP_001158035.1.61284 WP_001158035.1.613 WP_001158035.1.61360 WP_001158035.1.61364 WP_001158035.1.6138 WP_001158035.1.61442 WP_001158035.1.61445 WP_001158035.1.61480 WP_001158035.1.615 WP_001158035.1.61512 WP_001158035.1.61617 WP_001158035.1.61739 WP_001158035.1.61770 WP_001158035.1.61789 WP_001158035.1.61835 WP_001158035.1.61926 WP_001158035.1.61939 WP_001158035.1.61948 WP_001158035.1.61957 WP_001158035.1.61985 WP_001158035.1.62038 WP_001158035.1.62041 WP_001158035.1.62043 WP_001158035.1.62091 WP_001158035.1.62102 WP_001158035.1.62236 WP_001158035.1.62262 WP_001158035.1.62322 WP_001158035.1.62337 WP_001158035.1.62358 WP_001158035.1.62424 WP_001158035.1.62447 WP_001158035.1.62454 WP_001158035.1.62460 WP_001158035.1.62481 WP_001158035.1.62514 WP_001158035.1.62529 WP_001158035.1.62541 WP_001158035.1.62555 WP_001158035.1.62586 WP_001158035.1.62631 WP_001158035.1.62681 WP_001158035.1.62762 WP_001158035.1.62780 WP_001158035.1.62784 WP_001158035.1.62788 WP_001158035.1.62819 WP_001158035.1.6282 WP_001158035.1.62850 WP_001158035.1.62851 WP_001158035.1.62866 WP_001158035.1.62885 WP_001158035.1.62951 WP_001158035.1.62959 WP_001158035.1.62973 WP_001158035.1.6299 WP_001158035.1.6307 WP_001158035.1.63113 WP_001158035.1.63271 WP_001158035.1.63285 WP_001158035.1.63305 WP_001158035.1.63310 WP_001158035.1.63330 WP_001158035.1.63370 WP_001158035.1.63374 WP_001158035.1.63419 WP_001158035.1.63433 WP_001158035.1.63437 WP_001158035.1.63465 WP_001158035.1.63466 WP_001158035.1.63467 WP_001158035.1.63470 WP_001158035.1.63484 WP_001158035.1.63487 WP_001158035.1.63496 WP_001158035.1.63536 WP_001158035.1.63556 WP_001158035.1.63604 WP_001158035.1.63608 WP_001158035.1.63666 WP_001158035.1.63679 WP_001158035.1.63746 WP_001158035.1.63814 WP_001158035.1.63856 WP_001158035.1.63944 WP_001158035.1.63969 WP_001158035.1.64014 WP_001158035.1.64030 WP_001158035.1.64045 WP_001158035.1.64050 WP_001158035.1.64053 WP_001158035.1.64074 WP_001158035.1.64138 WP_001158035.1.64150 WP_001158035.1.64165 WP_001158035.1.64175 WP_001158035.1.64180 WP_001158035.1.64190 WP_001158035.1.643 WP_001158035.1.64312 WP_001158035.1.64330 WP_001158035.1.64355 WP_001158035.1.64356 WP_001158035.1.64417 WP_001158035.1.64438 WP_001158035.1.6444 WP_001158035.1.6446 WP_001158035.1.64520 WP_001158035.1.64528 WP_001158035.1.64547 WP_001158035.1.64670 WP_001158035.1.64693 WP_001158035.1.64695 WP_001158035.1.64707 WP_001158035.1.64712 WP_001158035.1.64840 WP_001158035.1.64875 WP_001158035.1.64881 WP_001158035.1.64901 WP_001158035.1.64970 WP_001158035.1.6500 WP_001158035.1.65061 WP_001158035.1.65104 WP_001158035.1.65114 WP_001158035.1.65116 WP_001158035.1.65151 WP_001158035.1.65155 WP_001158035.1.65240 WP_001158035.1.6527 WP_001158035.1.65286 WP_001158035.1.65305 WP_001158035.1.65306 WP_001158035.1.65355 WP_001158035.1.65366 WP_001158035.1.65370 WP_001158035.1.654 WP_001158035.1.65405 WP_001158035.1.65408 WP_001158035.1.65413 WP_001158035.1.65456 WP_001158035.1.65531 WP_001158035.1.65565 WP_001158035.1.65571 WP_001158035.1.65581 WP_001158035.1.65606 WP_001158035.1.65708 WP_001158035.1.65749 WP_001158035.1.6576 WP_001158035.1.65762 WP_001158035.1.65834 WP_001158035.1.65957 WP_001158035.1.65962 WP_001158035.1.65976 WP_001158035.1.6599 WP_001158035.1.66001 WP_001158035.1.66016 WP_001158035.1.66017 WP_001158035.1.66022 WP_001158035.1.66044 WP_001158035.1.66071 WP_001158035.1.66094 WP_001158035.1.66161 WP_001158035.1.6618 WP_001158035.1.66181 WP_001158035.1.66255 WP_001158035.1.66288 WP_001158035.1.66290 WP_001158035.1.66295 WP_001158035.1.66376 WP_001158035.1.66392 WP_001158035.1.66412 WP_001158035.1.66421 WP_001158035.1.66448 WP_001158035.1.6645 WP_001158035.1.66511 WP_001158035.1.66523 WP_001158035.1.66579 WP_001158035.1.6666 WP_001158035.1.66667 WP_001158035.1.66668 WP_001158035.1.66706 WP_001158035.1.66708 WP_001158035.1.66727 WP_001158035.1.66751 WP_001158035.1.66783 WP_001158035.1.66787 WP_001158035.1.66794 WP_001158035.1.66849 WP_001158035.1.66948 WP_001158035.1.6698 WP_001158035.1.66984 WP_001158035.1.67018 WP_001158035.1.67029 WP_001158035.1.67035 WP_001158035.1.67047 WP_001158035.1.67055 WP_001158035.1.6706 WP_001158035.1.67102 WP_001158035.1.67120 WP_001158035.1.67132 WP_001158035.1.67153 WP_001158035.1.67164 WP_001158035.1.67174 WP_001158035.1.67194 WP_001158035.1.6723 WP_001158035.1.67258 WP_001158035.1.67272 WP_001158035.1.67284 WP_001158035.1.67383 WP_001158035.1.67427 WP_001158035.1.67456 WP_001158035.1.67464 WP_001158035.1.67495 WP_001158035.1.67522 WP_001158035.1.67581 WP_001158035.1.67590 WP_001158035.1.67606 WP_001158035.1.67669 WP_001158035.1.67681 WP_001158035.1.67685 WP_001158035.1.67690 WP_001158035.1.67701 WP_001158035.1.67724 WP_001158035.1.67737 WP_001158035.1.67758 WP_001158035.1.67760 WP_001158035.1.678 WP_001158035.1.67841 WP_001158035.1.67891 WP_001158035.1.67894 WP_001158035.1.6793 WP_001158035.1.67975 WP_001158035.1.67992 WP_001158035.1.68011 WP_001158035.1.6802 WP_001158035.1.68052 WP_001158035.1.68058 WP_001158035.1.68059 WP_001158035.1.68063 WP_001158035.1.68070 WP_001158035.1.68071 WP_001158035.1.6810 WP_001158035.1.68138 WP_001158035.1.68157 WP_001158035.1.68177 WP_001158035.1.682 WP_001158035.1.68200 WP_001158035.1.68231 WP_001158035.1.68241 WP_001158035.1.68255 WP_001158035.1.68279 WP_001158035.1.68292 WP_001158035.1.68300 WP_001158035.1.68347 WP_001158035.1.68362 WP_001158035.1.68372 WP_001158035.1.68395 WP_001158035.1.68441 WP_001158035.1.68442 WP_001158035.1.68524 WP_001158035.1.68572 WP_001158035.1.6859 WP_001158035.1.6860 WP_001158035.1.68609 WP_001158035.1.68632 WP_001158035.1.68673 WP_001158035.1.68678 WP_001158035.1.68695 WP_001158035.1.68701 WP_001158035.1.68735 WP_001158035.1.68750 WP_001158035.1.68751 WP_001158035.1.68793 WP_001158035.1.68795 WP_001158035.1.68838 WP_001158035.1.68847 WP_001158035.1.68877 WP_001158035.1.68911 WP_001158035.1.68924 WP_001158035.1.68942 WP_001158035.1.68952 WP_001158035.1.68995 WP_001158035.1.69033 WP_001158035.1.69098 WP_001158035.1.69126 WP_001158035.1.69158 WP_001158035.1.69160 WP_001158035.1.6921 WP_001158035.1.69221 WP_001158035.1.69327 WP_001158035.1.69341 WP_001158035.1.69382 WP_001158035.1.69390 WP_001158035.1.69438 WP_001158035.1.69450 WP_001158035.1.69472 WP_001158035.1.69502 WP_001158035.1.69506 WP_001158035.1.69569 WP_001158035.1.69605 WP_001158035.1.69643 WP_001158035.1.69689 WP_001158035.1.697 WP_001158035.1.69716 WP_001158035.1.69735 WP_001158035.1.69786 WP_001158035.1.69831 WP_001158035.1.69832 WP_001158035.1.69872 WP_001158035.1.69887 WP_001158035.1.69963 WP_001158035.1.69972 WP_001158035.1.69999 WP_001158035.1.7001 WP_001158035.1.70041 WP_001158035.1.70063 WP_001158035.1.701 WP_001158035.1.7013 WP_001158035.1.7015 WP_001158035.1.70213 WP_001158035.1.70230 WP_001158035.1.70300 WP_001158035.1.70337 WP_001158035.1.70357 WP_001158035.1.70386 WP_001158035.1.70408 WP_001158035.1.70414 WP_001158035.1.7050 WP_001158035.1.7052 WP_001158035.1.70563 WP_001158035.1.70578 WP_001158035.1.70582 WP_001158035.1.70597 WP_001158035.1.70628 WP_001158035.1.70655 WP_001158035.1.70745 WP_001158035.1.70748 WP_001158035.1.70801 WP_001158035.1.70967 WP_001158035.1.7102 WP_001158035.1.71042 WP_001158035.1.71062 WP_001158035.1.71109 WP_001158035.1.71113 WP_001158035.1.71134 WP_001158035.1.71139 WP_001158035.1.71144 WP_001158035.1.71147 WP_001158035.1.71162 WP_001158035.1.71183 WP_001158035.1.7121 WP_001158035.1.71275 WP_001158035.1.71287 WP_001158035.1.71294 WP_001158035.1.71311 WP_001158035.1.71339 WP_001158035.1.71421 WP_001158035.1.71538 WP_001158035.1.71562 WP_001158035.1.71563 WP_001158035.1.71607 WP_001158035.1.71680 WP_001158035.1.71732 WP_001158035.1.71757 WP_001158035.1.71830 WP_001158035.1.71855 WP_001158035.1.71856 WP_001158035.1.71874 WP_001158035.1.71912 WP_001158035.1.71939 WP_001158035.1.71967 WP_001158035.1.71972 WP_001158035.1.71995 WP_001158035.1.72013 WP_001158035.1.72021 WP_001158035.1.72028 WP_001158035.1.72048 WP_001158035.1.72053 WP_001158035.1.72098 WP_001158035.1.72117 WP_001158035.1.72125 WP_001158035.1.72141 WP_001158035.1.72161 WP_001158035.1.72162 WP_001158035.1.72186 WP_001158035.1.72208 WP_001158035.1.72212 WP_001158035.1.72248 WP_001158035.1.7225 WP_001158035.1.72258 WP_001158035.1.72270 WP_001158035.1.72290 WP_001158035.1.72298 WP_001158035.1.723 WP_001158035.1.72316 WP_001158035.1.72352 WP_001158035.1.72359 WP_001158035.1.72388 WP_001158035.1.72425 WP_001158035.1.72436 WP_001158035.1.72469 WP_001158035.1.72493 WP_001158035.1.72507 WP_001158035.1.72551 WP_001158035.1.72588 WP_001158035.1.72596 WP_001158035.1.72599 WP_001158035.1.72608 WP_001158035.1.72616 WP_001158035.1.72619 WP_001158035.1.72695 WP_001158035.1.72700 WP_001158035.1.72706 WP_001158035.1.72751 WP_001158035.1.7277 WP_001158035.1.7281 WP_001158035.1.72837 WP_001158035.1.72857 WP_001158035.1.72858 WP_001158035.1.72869 WP_001158035.1.72893 WP_001158035.1.72950 WP_001158035.1.72962 WP_001158035.1.73000 WP_001158035.1.73010 WP_001158035.1.73032 WP_001158035.1.73039 WP_001158035.1.73061 WP_001158035.1.7307 WP_001158035.1.73072 WP_001158035.1.73075 WP_001158035.1.7309 WP_001158035.1.73094 WP_001158035.1.73197 WP_001158035.1.73215 WP_001158035.1.73239 WP_001158035.1.73249 WP_001158035.1.73257 WP_001158035.1.73259 WP_001158035.1.73277 WP_001158035.1.73283 WP_001158035.1.73291 WP_001158035.1.73326 WP_001158035.1.73333 WP_001158035.1.73344 WP_001158035.1.73428 WP_001158035.1.73430 WP_001158035.1.7345 WP_001158035.1.73468 WP_001158035.1.73486 WP_001158035.1.73572 WP_001158035.1.73663 WP_001158035.1.73700 WP_001158035.1.73709 WP_001158035.1.73748 WP_001158035.1.73783 WP_001158035.1.73797 WP_001158035.1.73846 WP_001158035.1.73882 WP_001158035.1.73908 WP_001158035.1.73995 WP_001158035.1.74032 WP_001158035.1.74041 WP_001158035.1.74045 WP_001158035.1.74046 WP_001158035.1.7407 WP_001158035.1.7413 WP_001158035.1.74156 WP_001158035.1.74185 WP_001158035.1.74267 WP_001158035.1.74358 WP_001158035.1.74367 WP_001158035.1.744 WP_001158035.1.74426 WP_001158035.1.74431 WP_001158035.1.74444 WP_001158035.1.74478 WP_001158035.1.74491 WP_001158035.1.74501 WP_001158035.1.74532 WP_001158035.1.74549 WP_001158035.1.74574 WP_001158035.1.74611 WP_001158035.1.74623 WP_001158035.1.74631 WP_001158035.1.74652 WP_001158035.1.74682 WP_001158035.1.74688 WP_001158035.1.74689 WP_001158035.1.74735 WP_001158035.1.74752 WP_001158035.1.74765 WP_001158035.1.74767 WP_001158035.1.7478 WP_001158035.1.74844 WP_001158035.1.74852 WP_001158035.1.74880 WP_001158035.1.74885 WP_001158035.1.74889 WP_001158035.1.74895 WP_001158035.1.74915 WP_001158035.1.74962 WP_001158035.1.75021 WP_001158035.1.75087 WP_001158035.1.75100 WP_001158035.1.75112 WP_001158035.1.75118 WP_001158035.1.75136 WP_001158035.1.7516 WP_001158035.1.75181 WP_001158035.1.75218 WP_001158035.1.75228 WP_001158035.1.75254 WP_001158035.1.75272 WP_001158035.1.75306 WP_001158035.1.75360 WP_001158035.1.75419 WP_001158035.1.75435 WP_001158035.1.75465 WP_001158035.1.75557 WP_001158035.1.75588 WP_001158035.1.75629 WP_001158035.1.75644 WP_001158035.1.75676 WP_001158035.1.75699 WP_001158035.1.75725 WP_001158035.1.75786 WP_001158035.1.75808 WP_001158035.1.75839 WP_001158035.1.75853 WP_001158035.1.75892 WP_001158035.1.75918 WP_001158035.1.75973 WP_001158035.1.76009 WP_001158035.1.76019 WP_001158035.1.7603 WP_001158035.1.76030 WP_001158035.1.76036 WP_001158035.1.76057 WP_001158035.1.76103 WP_001158035.1.76119 WP_001158035.1.76129 WP_001158035.1.7613 WP_001158035.1.7617 WP_001158035.1.76194 WP_001158035.1.76237 WP_001158035.1.76268 WP_001158035.1.76269 WP_001158035.1.76305 WP_001158035.1.76335 WP_001158035.1.76469 WP_001158035.1.76504 WP_001158035.1.76542 WP_001158035.1.76596 WP_001158035.1.7661 WP_001158035.1.76619 WP_001158035.1.76643 WP_001158035.1.76656 WP_001158035.1.76660 WP_001158035.1.76751 WP_001158035.1.76759 WP_001158035.1.7680 WP_001158035.1.76831 WP_001158035.1.76863 WP_001158035.1.7689 WP_001158035.1.76961 WP_001158035.1.76966 WP_001158035.1.7699 WP_001158035.1.76994 WP_001158035.1.77007 WP_001158035.1.77022 WP_001158035.1.77036 WP_001158035.1.77042 WP_001158035.1.77057 WP_001158035.1.77081 WP_001158035.1.771 WP_001158035.1.77109 WP_001158035.1.77134 WP_001158035.1.77147 WP_001158035.1.77162 WP_001158035.1.77163 WP_001158035.1.77200 WP_001158035.1.77204 WP_001158035.1.77224 WP_001158035.1.77253 WP_001158035.1.77258 WP_001158035.1.7729 WP_001158035.1.77290 WP_001158035.1.77296 WP_001158035.1.77320 WP_001158035.1.77408 WP_001158035.1.77419 WP_001158035.1.77432 WP_001158035.1.77437 WP_001158035.1.77455 WP_001158035.1.77462 WP_001158035.1.7747 WP_001158035.1.77477 WP_001158035.1.77481 WP_001158035.1.77487 WP_001158035.1.77495 WP_001158035.1.7750 WP_001158035.1.77511 WP_001158035.1.77551 WP_001158035.1.77577 WP_001158035.1.77608 WP_001158035.1.77626 WP_001158035.1.77632 WP_001158035.1.77643 WP_001158035.1.77657 WP_001158035.1.7775 WP_001158035.1.7780 WP_001158035.1.7781 WP_001158035.1.77816 WP_001158035.1.77826 WP_001158035.1.77833 WP_001158035.1.77950 WP_001158035.1.77999 WP_001158035.1.78010 WP_001158035.1.7804 WP_001158035.1.7808 WP_001158035.1.78099 WP_001158035.1.78102 WP_001158035.1.78131 WP_001158035.1.78183 WP_001158035.1.78187 WP_001158035.1.78188 WP_001158035.1.78202 WP_001158035.1.78232 WP_001158035.1.78233 WP_001158035.1.78305 WP_001158035.1.78337 WP_001158035.1.78368 WP_001158035.1.78376 WP_001158035.1.78445 WP_001158035.1.78453 WP_001158035.1.78463 WP_001158035.1.78477 WP_001158035.1.78491 WP_001158035.1.78512 WP_001158035.1.78527 WP_001158035.1.78572 WP_001158035.1.78575 WP_001158035.1.78610 WP_001158035.1.78622 WP_001158035.1.78677 WP_001158035.1.78683 WP_001158035.1.78689 WP_001158035.1.78698 WP_001158035.1.78706 WP_001158035.1.78714 WP_001158035.1.78757 WP_001158035.1.78773 WP_001158035.1.78775 WP_001158035.1.78814 WP_001158035.1.7883 WP_001158035.1.78843 WP_001158035.1.78845 WP_001158035.1.78893 WP_001158035.1.78895 WP_001158035.1.78908 WP_001158035.1.78955 WP_001158035.1.78966 WP_001158035.1.78996 WP_001158035.1.79001 WP_001158035.1.79065 WP_001158035.1.79067 WP_001158035.1.79075 WP_001158035.1.79100 WP_001158035.1.79126 WP_001158035.1.79137 WP_001158035.1.79159 WP_001158035.1.79233 WP_001158035.1.79243 WP_001158035.1.79248 WP_001158035.1.79249 WP_001158035.1.79276 WP_001158035.1.79342 WP_001158035.1.79348 WP_001158035.1.79365 WP_001158035.1.79368 WP_001158035.1.7937 WP_001158035.1.79389 WP_001158035.1.79409 WP_001158035.1.79414 WP_001158035.1.79443 WP_001158035.1.79505 WP_001158035.1.7952 WP_001158035.1.79525 WP_001158035.1.79540 WP_001158035.1.79591 WP_001158035.1.79606 WP_001158035.1.79619 WP_001158035.1.79640 WP_001158035.1.7967 WP_001158035.1.79707 WP_001158035.1.79713 WP_001158035.1.79749 WP_001158035.1.79759 WP_001158035.1.79824 WP_001158035.1.79933 WP_001158035.1.79952 WP_001158035.1.79955 WP_001158035.1.79973 WP_001158035.1.79995 WP_001158035.1.80 WP_001158035.1.80026 WP_001158035.1.8004 WP_001158035.1.80043 WP_001158035.1.80063 WP_001158035.1.80071 WP_001158035.1.80096 WP_001158035.1.8011 WP_001158035.1.80112 WP_001158035.1.80141 WP_001158035.1.80168 WP_001158035.1.80176 WP_001158035.1.80343 WP_001158035.1.80392 WP_001158035.1.804 WP_001158035.1.80484 WP_001158035.1.80558 WP_001158035.1.80559 WP_001158035.1.80577 WP_001158035.1.80660 WP_001158035.1.8068 WP_001158035.1.80709 WP_001158035.1.80718 WP_001158035.1.80724 WP_001158035.1.80754 WP_001158035.1.80768 WP_001158035.1.80862 WP_001158035.1.80894 WP_001158035.1.80935 WP_001158035.1.80945 WP_001158035.1.80946 WP_001158035.1.80948 WP_001158035.1.80983 WP_001158035.1.810 WP_001158035.1.81026 WP_001158035.1.81032 WP_001158035.1.81056 WP_001158035.1.81098 WP_001158035.1.811 WP_001158035.1.81120 WP_001158035.1.81141 WP_001158035.1.81156 WP_001158035.1.81165 WP_001158035.1.8118 WP_001158035.1.81186 WP_001158035.1.81266 WP_001158035.1.81267 WP_001158035.1.81316 WP_001158035.1.81323 WP_001158035.1.81347 WP_001158035.1.81376 WP_001158035.1.81396 WP_001158035.1.814 WP_001158035.1.81418 WP_001158035.1.81423 WP_001158035.1.81438 WP_001158035.1.81475 WP_001158035.1.81484 WP_001158035.1.81517 WP_001158035.1.81580 WP_001158035.1.81588 WP_001158035.1.81624 WP_001158035.1.81625 WP_001158035.1.81761 WP_001158035.1.8183 WP_001158035.1.81843 WP_001158035.1.81888 WP_001158035.1.82 WP_001158035.1.82008 WP_001158035.1.82104 WP_001158035.1.82106 WP_001158035.1.82123 WP_001158035.1.82166 WP_001158035.1.82217 WP_001158035.1.82221 WP_001158035.1.82239 WP_001158035.1.82242 WP_001158035.1.82246 WP_001158035.1.82378 WP_001158035.1.82514 WP_001158035.1.82527 WP_001158035.1.82539 WP_001158035.1.8255 WP_001158035.1.82572 WP_001158035.1.82589 WP_001158035.1.82691 WP_001158035.1.82698 WP_001158035.1.82747 WP_001158035.1.8277 WP_001158035.1.82776 WP_001158035.1.82784 WP_001158035.1.82799 WP_001158035.1.82808 WP_001158035.1.82816 WP_001158035.1.82831 WP_001158035.1.82833 WP_001158035.1.82901 WP_001158035.1.82923 WP_001158035.1.8295 WP_001158035.1.82991 WP_001158035.1.83035 WP_001158035.1.83059 WP_001158035.1.8306 WP_001158035.1.83118 WP_001158035.1.83125 WP_001158035.1.83127 WP_001158035.1.83151 WP_001158035.1.83214 WP_001158035.1.83218 WP_001158035.1.83238 WP_001158035.1.83253 WP_001158035.1.83256 WP_001158035.1.83313 WP_001158035.1.83375 WP_001158035.1.83393 WP_001158035.1.83506 WP_001158035.1.83582 WP_001158035.1.83644 WP_001158035.1.83660 WP_001158035.1.83668 WP_001158035.1.8368 WP_001158035.1.83684 WP_001158035.1.8384 WP_001158035.1.83879 WP_001158035.1.83911 WP_001158035.1.83936 WP_001158035.1.83947 WP_001158035.1.84014 WP_001158035.1.8405 WP_001158035.1.84059 WP_001158035.1.84060 WP_001158035.1.8408 WP_001158035.1.84140 WP_001158035.1.84197 WP_001158035.1.84215 WP_001158035.1.84221 WP_001158035.1.84316 WP_001158035.1.84319 WP_001158035.1.84326 WP_001158035.1.84348 WP_001158035.1.84402 WP_001158035.1.84436 WP_001158035.1.84464 WP_001158035.1.8447 WP_001158035.1.84473 WP_001158035.1.84476 WP_001158035.1.84484 WP_001158035.1.84486 WP_001158035.1.84511 WP_001158035.1.84531 WP_001158035.1.84639 WP_001158035.1.84656 WP_001158035.1.84697 WP_001158035.1.8470 WP_001158035.1.84731 WP_001158035.1.84881 WP_001158035.1.84894 WP_001158035.1.84941 WP_001158035.1.85011 WP_001158035.1.85025 WP_001158035.1.85048 WP_001158035.1.85077 WP_001158035.1.85106 WP_001158035.1.85125 WP_001158035.1.85138 WP_001158035.1.8517 WP_001158035.1.85175 WP_001158035.1.85188 WP_001158035.1.85241 WP_001158035.1.85252 WP_001158035.1.85315 WP_001158035.1.85320 WP_001158035.1.85329 WP_001158035.1.85335 WP_001158035.1.85336 WP_001158035.1.85342 WP_001158035.1.85361 WP_001158035.1.85384 WP_001158035.1.85504 WP_001158035.1.85525 WP_001158035.1.85554 WP_001158035.1.85556 WP_001158035.1.85578 WP_001158035.1.85593 WP_001158035.1.85623 WP_001158035.1.8564 WP_001158035.1.85657 WP_001158035.1.85762 WP_001158035.1.85781 WP_001158035.1.85806 WP_001158035.1.85939 WP_001158035.1.85944 WP_001158035.1.8603 WP_001158035.1.86035 WP_001158035.1.86104 WP_001158035.1.86115 WP_001158035.1.86149 WP_001158035.1.86166 WP_001158035.1.86176 WP_001158035.1.86179 WP_001158035.1.86181 WP_001158035.1.86196 WP_001158035.1.86210 WP_001158035.1.86227 WP_001158035.1.86234 WP_001158035.1.86261 WP_001158035.1.86263 WP_001158035.1.86266 WP_001158035.1.86273 WP_001158035.1.86283 WP_001158035.1.86294 WP_001158035.1.86353 WP_001158035.1.86355 WP_001158035.1.86371 WP_001158035.1.86411 WP_001158035.1.86437 WP_001158035.1.86451 WP_001158035.1.86454 WP_001158035.1.86492 WP_001158035.1.8652 WP_001158035.1.8656 WP_001158035.1.86560 WP_001158035.1.86583 WP_001158035.1.86586 WP_001158035.1.86613 WP_001158035.1.86617 WP_001158035.1.86627 WP_001158035.1.86640 WP_001158035.1.86673 WP_001158035.1.86674 WP_001158035.1.86707 WP_001158035.1.86727 WP_001158035.1.86731 WP_001158035.1.86734 WP_001158035.1.86753 WP_001158035.1.86768 WP_001158035.1.86788 WP_001158035.1.8679 WP_001158035.1.87043 WP_001158035.1.8705 WP_001158035.1.87067 WP_001158035.1.87074 WP_001158035.1.87075 WP_001158035.1.87102 WP_001158035.1.87147 WP_001158035.1.87189 WP_001158035.1.87205 WP_001158035.1.87249 WP_001158035.1.87371 WP_001158035.1.87443 WP_001158035.1.87465 WP_001158035.1.87491 WP_001158035.1.87504 WP_001158035.1.87557 WP_001158035.1.87568 WP_001158035.1.87581 WP_001158035.1.87590 WP_001158035.1.87633 WP_001158035.1.87635 WP_001158035.1.87639 WP_001158035.1.87675 WP_001158035.1.87694 WP_001158035.1.87696 WP_001158035.1.87738 WP_001158035.1.87766 WP_001158035.1.8778 WP_001158035.1.87788 WP_001158035.1.87789 WP_001158035.1.87822 WP_001158035.1.87857 WP_001158035.1.87883 WP_001158035.1.87976 WP_001158035.1.87980 WP_001158035.1.87990 WP_001158035.1.88020 WP_001158035.1.88082 WP_001158035.1.88119 WP_001158035.1.88147 WP_001158035.1.88149 WP_001158035.1.88155 WP_001158035.1.8822 WP_001158035.1.88234 WP_001158035.1.88238 WP_001158035.1.88252 WP_001158035.1.88260 WP_001158035.1.88285 WP_001158035.1.88336 WP_001158035.1.88376 WP_001158035.1.88384 WP_001158035.1.88427 WP_001158035.1.88467 WP_001158035.1.8848 WP_001158035.1.88499 WP_001158035.1.88505 WP_001158035.1.88527 WP_001158035.1.88535 WP_001158035.1.88539 WP_001158035.1.8855 WP_001158035.1.88562 WP_001158035.1.88598 WP_001158035.1.88631 WP_001158035.1.88646 WP_001158035.1.88686 WP_001158035.1.88717 WP_001158035.1.8873 WP_001158035.1.88732 WP_001158035.1.88752 WP_001158035.1.88759 WP_001158035.1.88767 WP_001158035.1.88793 WP_001158035.1.88826 WP_001158035.1.88880 WP_001158035.1.88883 WP_001158035.1.88941 WP_001158035.1.88953 WP_001158035.1.89043 WP_001158035.1.89050 WP_001158035.1.8906 WP_001158035.1.89067 WP_001158035.1.89069 WP_001158035.1.89090 WP_001158035.1.89150 WP_001158035.1.89163 WP_001158035.1.89183 WP_001158035.1.89203 WP_001158035.1.89214 WP_001158035.1.89217 WP_001158035.1.89285 WP_001158035.1.89334 WP_001158035.1.89351 WP_001158035.1.89379 WP_001158035.1.8938 WP_001158035.1.89396 WP_001158035.1.89427 WP_001158035.1.89466 WP_001158035.1.89469 WP_001158035.1.89474 WP_001158035.1.89479 WP_001158035.1.89492 WP_001158035.1.89551 WP_001158035.1.89583 WP_001158035.1.89631 WP_001158035.1.89646 WP_001158035.1.89710 WP_001158035.1.89747 WP_001158035.1.89818 WP_001158035.1.89839 WP_001158035.1.89879 WP_001158035.1.89915 WP_001158035.1.89917 WP_001158035.1.89918 WP_001158035.1.90022 WP_001158035.1.90050 WP_001158035.1.9010 WP_001158035.1.90156 WP_001158035.1.90168 WP_001158035.1.90171 WP_001158035.1.902 WP_001158035.1.90256 WP_001158035.1.90266 WP_001158035.1.90346 WP_001158035.1.90357 WP_001158035.1.9037 WP_001158035.1.90405 WP_001158035.1.90435 WP_001158035.1.90441 WP_001158035.1.90525 WP_001158035.1.90542 WP_001158035.1.90547 WP_001158035.1.90602 WP_001158035.1.90626 WP_001158035.1.90706 WP_001158035.1.90775 WP_001158035.1.9081 WP_001158035.1.90813 WP_001158035.1.90822 WP_001158035.1.90834 WP_001158035.1.90842 WP_001158035.1.90844 WP_001158035.1.90856 WP_001158035.1.90864 WP_001158035.1.9087 WP_001158035.1.90873 WP_001158035.1.90890 WP_001158035.1.909 WP_001158035.1.90905 WP_001158035.1.90924 WP_001158035.1.90960 WP_001158035.1.90979 WP_001158035.1.90988 WP_001158035.1.90996 WP_001158035.1.91 WP_001158035.1.91007 WP_001158035.1.91010 WP_001158035.1.9104 WP_001158035.1.91094 WP_001158035.1.91143 WP_001158035.1.91182 WP_001158035.1.9119 WP_001158035.1.91213 WP_001158035.1.91220 WP_001158035.1.91266 WP_001158035.1.91268 WP_001158035.1.91290 WP_001158035.1.91354 WP_001158035.1.91361 WP_001158035.1.91397 WP_001158035.1.91425 WP_001158035.1.91445 WP_001158035.1.91482 WP_001158035.1.91485 WP_001158035.1.91511 WP_001158035.1.91515 WP_001158035.1.91516 WP_001158035.1.91543 WP_001158035.1.91549 WP_001158035.1.91565 WP_001158035.1.91566 WP_001158035.1.9157 WP_001158035.1.91596 WP_001158035.1.9160 WP_001158035.1.91626 WP_001158035.1.91644 WP_001158035.1.91666 WP_001158035.1.91672 WP_001158035.1.91756 WP_001158035.1.91782 WP_001158035.1.91787 WP_001158035.1.91814 WP_001158035.1.91843 WP_001158035.1.91887 WP_001158035.1.91893 WP_001158035.1.91954 WP_001158035.1.91959 WP_001158035.1.91965 WP_001158035.1.91971 WP_001158035.1.9199 WP_001158035.1.92025 WP_001158035.1.92048 WP_001158035.1.92053 WP_001158035.1.9209 WP_001158035.1.92096 WP_001158035.1.921 WP_001158035.1.92102 WP_001158035.1.92163 WP_001158035.1.92201 WP_001158035.1.92276 WP_001158035.1.92295 WP_001158035.1.92305 WP_001158035.1.92311 WP_001158035.1.92384 WP_001158035.1.92403 WP_001158035.1.92434 WP_001158035.1.92473 WP_001158035.1.9255 WP_001158035.1.92634 WP_001158035.1.92638 WP_001158035.1.92648 WP_001158035.1.92719 WP_001158035.1.92750 WP_001158035.1.92767 WP_001158035.1.92780 WP_001158035.1.92781 WP_001158035.1.92882 WP_001158035.1.92886 WP_001158035.1.93017 WP_001158035.1.93033 WP_001158035.1.93052 WP_001158035.1.93100 WP_001158035.1.93138 WP_001158035.1.93139 WP_001158035.1.93167 WP_001158035.1.93185 WP_001158035.1.93291 WP_001158035.1.9331 WP_001158035.1.93326 WP_001158035.1.93338 WP_001158035.1.934 WP_001158035.1.93431 WP_001158035.1.93453 WP_001158035.1.93461 WP_001158035.1.93464 WP_001158035.1.93531 WP_001158035.1.93533 WP_001158035.1.93552 WP_001158035.1.9356 WP_001158035.1.93621 WP_001158035.1.93665 WP_001158035.1.93679 WP_001158035.1.93694 WP_001158035.1.93716 WP_001158035.1.93733 WP_001158035.1.93737 WP_001158035.1.93765 WP_001158035.1.93768 WP_001158035.1.93800 WP_001158035.1.93870 WP_001158035.1.93922 WP_001158035.1.93939 WP_001158035.1.93951 WP_001158035.1.94008 WP_001158035.1.94028 WP_001158035.1.94035 WP_001158035.1.94040 WP_001158035.1.94069 WP_001158035.1.94156 WP_001158035.1.9416 WP_001158035.1.9420 WP_001158035.1.94232 WP_001158035.1.94282 WP_001158035.1.94298 WP_001158035.1.94317 WP_001158035.1.94353 WP_001158035.1.94367 WP_001158035.1.94404 WP_001158035.1.94417 WP_001158035.1.94430 WP_001158035.1.94436 WP_001158035.1.94438 WP_001158035.1.94446 WP_001158035.1.94468 WP_001158035.1.94475 WP_001158035.1.94507 WP_001158035.1.94580 WP_001158035.1.94619 WP_001158035.1.94653 WP_001158035.1.94704 WP_001158035.1.94739 WP_001158035.1.9474 WP_001158035.1.94808 WP_001158035.1.94822 WP_001158035.1.94823 WP_001158035.1.94841 WP_001158035.1.94847 WP_001158035.1.94869 WP_001158035.1.94892 WP_001158035.1.94903 WP_001158035.1.9491 WP_001158035.1.94927 WP_001158035.1.94934 WP_001158035.1.94955 WP_001158035.1.94997 WP_001158035.1.95022 WP_001158035.1.95080 WP_001158035.1.95084 WP_001158035.1.95105 WP_001158035.1.9513 WP_001158035.1.95161 WP_001158035.1.95243 WP_001158035.1.95244 WP_001158035.1.95310 WP_001158035.1.95329 WP_001158035.1.95364 WP_001158035.1.95366 WP_001158035.1.95368 WP_001158035.1.95378 WP_001158035.1.95398 WP_001158035.1.95400 WP_001158035.1.95424 WP_001158035.1.95428 WP_001158035.1.95449 WP_001158035.1.95490 WP_001158035.1.95563 WP_001158035.1.9559 WP_001158035.1.95604 WP_001158035.1.95628 WP_001158035.1.95655 WP_001158035.1.9566 WP_001158035.1.95666 WP_001158035.1.95680 WP_001158035.1.95783 WP_001158035.1.95784 WP_001158035.1.95800 WP_001158035.1.95846 WP_001158035.1.95858 WP_001158035.1.95861 WP_001158035.1.95916 WP_001158035.1.95929 WP_001158035.1.95951 WP_001158035.1.96059 WP_001158035.1.96066 WP_001158035.1.96097 WP_001158035.1.96110 WP_001158035.1.96114 WP_001158035.1.96143 WP_001158035.1.96145 WP_001158035.1.96177 WP_001158035.1.96223 WP_001158035.1.96247 WP_001158035.1.96253 WP_001158035.1.96341 WP_001158035.1.96378 WP_001158035.1.96392 WP_001158035.1.9641 WP_001158035.1.96457 WP_001158035.1.96478 WP_001158035.1.9649 WP_001158035.1.96519 WP_001158035.1.96558 WP_001158035.1.96562 WP_001158035.1.96585 WP_001158035.1.9661 WP_001158035.1.96617 WP_001158035.1.96633 WP_001158035.1.96650 WP_001158035.1.96676 WP_001158035.1.9668 WP_001158035.1.96695 WP_001158035.1.9671 WP_001158035.1.96743 WP_001158035.1.96759 WP_001158035.1.96762 WP_001158035.1.96797 WP_001158035.1.96817 WP_001158035.1.9682 WP_001158035.1.96820 WP_001158035.1.96864 WP_001158035.1.96894 WP_001158035.1.96907 WP_001158035.1.9691 WP_001158035.1.96924 WP_001158035.1.96936 WP_001158035.1.96944 WP_001158035.1.96971 WP_001158035.1.97147 WP_001158035.1.97170 WP_001158035.1.97226 WP_001158035.1.9723 WP_001158035.1.97247 WP_001158035.1.97248 WP_001158035.1.97269 WP_001158035.1.97282 WP_001158035.1.97292 WP_001158035.1.97344 WP_001158035.1.97361 WP_001158035.1.97379 WP_001158035.1.97387 WP_001158035.1.97434 WP_001158035.1.97437 WP_001158035.1.97464 WP_001158035.1.97525 WP_001158035.1.97544 WP_001158035.1.97549 WP_001158035.1.97571 WP_001158035.1.97654 WP_001158035.1.97685 WP_001158035.1.97770 WP_001158035.1.97778 WP_001158035.1.978 WP_001158035.1.97822 WP_001158035.1.97823 WP_001158035.1.97890 WP_001158035.1.97919 WP_001158035.1.97962 WP_001158035.1.98000 WP_001158035.1.98005 WP_001158035.1.98026 WP_001158035.1.9803 WP_001158035.1.98082 WP_001158035.1.98102 WP_001158035.1.98139 WP_001158035.1.9816 WP_001158035.1.98167 WP_001158035.1.9817 WP_001158035.1.98232 WP_001158035.1.98239 WP_001158035.1.98251 WP_001158035.1.98292 WP_001158035.1.98301 WP_001158035.1.98357 WP_001158035.1.98400 WP_001158035.1.98429 WP_001158035.1.98466 WP_001158035.1.98480 WP_001158035.1.98484 WP_001158035.1.98549 WP_001158035.1.98626 WP_001158035.1.98633 WP_001158035.1.98665 WP_001158035.1.98702 WP_001158035.1.98727 WP_001158035.1.98757 WP_001158035.1.98775 WP_001158035.1.98784 WP_001158035.1.98795 WP_001158035.1.98875 WP_001158035.1.98988 WP_001158035.1.99006 WP_001158035.1.99029 WP_001158035.1.99046 WP_001158035.1.99060 WP_001158035.1.99168 WP_001158035.1.99246 WP_001158035.1.99289 WP_001158035.1.9930 WP_001158035.1.99302 WP_001158035.1.99304 WP_001158035.1.99306 WP_001158035.1.99307 WP_001158035.1.99334 WP_001158035.1.99349 WP_001158035.1.9935 WP_001158035.1.99361 WP_001158035.1.99366 WP_001158035.1.9940 WP_001158035.1.99401 WP_001158035.1.99458 WP_001158035.1.99472 WP_001158035.1.99475 WP_001158035.1.99498 WP_001158035.1.9950 WP_001158035.1.99511 WP_001158035.1.99549 WP_001158035.1.99571 WP_001158035.1.99592 WP_001158035.1.99619 WP_001158035.1.99632 WP_001158035.1.99666 WP_001158035.1.99694 WP_001158035.1.99698 WP_001158035.1.99734 WP_001158035.1.99771 WP_001158035.1.99782 WP_001158035.1.99869 WP_001158035.1.99874 WP_001158035.1.99892 YP_002409549.1.10275 YP_002414288.1.14968 YP_006121470.1.29421 YP_006777368.1.12065 gi|260869901|ref|YP_003236303.1| gi|386625957|ref|YP_006145685.1| gi|218551561|ref|YP_002385353.1| gi|110643390|ref|YP_671120.1| gi|544577700|ref|YP_008573224.1| gi|91212567|ref|YP_542553.1| 199310.c3903 331111.EcE24377A_3631 362663.ECP_3237 364106.UTI89_C3576 405955.APECO1_3281 439855.EcSMS35_3444 573235.ECO26_4254 574521.E2348C_3431 585034.ECIAI1_3299 585035.ECS88_3533 585054.EFER_4346 585055.EC55989_3569 585056.ECUMN_3629 585057.ECIAI39_3646 585395.ECO103_3898 585396.ECO111_3973 585397.ECED1_3809 gi|407471125|ref|YP_006782432.1| gi|386602766|ref|YP_006109066.1| gi|222157864|ref|YP_002558003.1| gi|387831036|ref|YP_003350973.1| gi|386711058|ref|YP_006174779.1| gi|386601176|ref|YP_006102682.1| gi|260845964|ref|YP_003223742.1| gi|260857277|ref|YP_003231168.1| gi|117625445|ref|YP_858768.1| gi|387608871|ref|YP_006097727.1| gi|386640754|ref|YP_006107552.1| gi|378711394|ref|YP_005276287.1| gi|218706769|ref|YP_002414288.1| gi|386620763|ref|YP_006140343.1| gi|218691441|ref|YP_002399653.1| gi|218555721|ref|YP_002388634.1| gi|26249730|ref|NP_755770.1| gi|556553057|ref|YP_008723525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]