SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187918929|ref|YP_001887960.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187918929|ref|YP_001887960.1|
Domain Number 1 Region: 114-180
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.28e-31
Family CO dehydrogenase ISP C-domain like 0.00038
Further Details:      
 
Domain Number 2 Region: 31-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187918929|ref|YP_001887960.1|
Sequence length 182
Comment (2Fe-2S)-binding domain-containing protein [Burkholderia phytofirmans PsJN]
Sequence
MMQQTASKTPQQSADPDAVRTTRQPSANATMPVELTVNGNLYTLSLDPRTTLLDALREHL
HLTGTKKGCDHGQCGACTVHVNGRRVNACLLLACAHAGDEITTIEGIGQPEALHPMQAAF
VECDGYQCGYCTSGQIMSAVALLGEAVGPDDAEVREAMSGNLCRCGAYQNIVAAIQRVRG
QS
Download sequence
Identical sequences B2TER9
gi|187918929|ref|YP_001887960.1| 398527.Bphyt_4209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]