SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187918961|ref|YP_001887992.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187918961|ref|YP_001887992.1|
Domain Number 1 Region: 215-324
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0022
Further Details:      
 
Domain Number 2 Region: 97-229
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.14e-26
Family Aromatic dioxygenase reductase-like 0.0092
Further Details:      
 
Domain Number 3 Region: 4-99
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.12e-23
Family Ferredoxin reductase FAD-binding domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187918961|ref|YP_001887992.1|
Sequence length 324
Comment ferredoxin [Burkholderia phytofirmans PsJN]
Sequence
MKSSETFEVEVRGIRIEAETVRSFELWPVSGELPPFTAGAHIDVHLSHGMTRQYSLTNSL
ERHRYVIAVQRDPGGAGGSMSMHDSVALGSRLIVSAPRNYFPLNEAAVHSVLIAGGIGVT
PLLAMVRRLCQLGLSWDFYYCARVPARAAFLSELKELAATTYPDRALHCVFDGEAGVTSL
NLGDVRAAHRPDSDFYCCGPAPLMDAFSTTFASLPPERVHLEYFKAPVADTLGEAEGAFT
VTLSRQGKTLVVPPNRSILEVLRENGVPMLSSCRQGICGTCETRVVEGVPDHRDHVLTPA
ERASNQTMMICVSRCKGEALTLDI
Download sequence
Identical sequences B2TEV1
WP_012426138.1.30149 398527.Bphyt_4243 gi|187918961|ref|YP_001887992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]